SecReT4
Protein ID: 229586347
T4SS name [ID]VirB [480]
Gene symbolvirB6-4
Locus tagRAF_ORF0134
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]143493..146168 [+]
ProductVirB6
Component typeVirB6
UniProt IDC3PME5
KEGG IDraf:RAF_ORF0134
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.9e-21, Aligned region: 521..715
Protein Sequence: 891 a.a.     [Download]
>gi|229586347|ref|YP_002844848.1| VirB6 [Rickettsia africae ESF-5]
MKILKSLVLLVLFMAMPAKADDAFSWMSTSFGGLKSLFGCLEVPGFTSFQEGNIGINLSTAGLWQSTGNT
VQKGKLLKINWSTSGITFEPRKYLVLYRIDPRFSMPQVFIKTYNYSKLQFEALGFPRFVTDNNSETPGTI
PPDKNLDALSFTKMSDFVKYFNYSNGNSRIEVKAGDVVNISLVGKDNFFSPNTLKLPNTVDNILTQELDS
SIFAASALYTQSNLGDFDNRIIYSSAEQVCNMIDKERKSVCSGTGTATKYKNTDNGVIVGKPMITGAVQY
FMGLIKACPANAGINTSPACYYDQGRGMIIKVGGQVIKGQDQSFVNSGSTQSSFIYYQATSGGTMDFTSD
WQVSNMFSNSVLMSDWSRNFSNYASFVDYINKNDWSANFLYFGCYSMIVEIGNGANLINPDDQQNIKLEY
LITSDGTLPDPSVRGMPVDYNFATDAPQDGYLWLRVVNPNSNIQGVVSVNYANYTGTTWFSDIIYNGAIK
PITDQFRTFSQNFYIKLVKNSAVQNLAKTALTLYVTIFGLMFVTGALKLTAVEVITRICKIAIVAFLIRE
ESWSFFNTYFFSAFTDGIDFFVTNVVGVTSSRSNIFGFIDPIFDKYTNGRIWGLLFIELLQIHNGLAFIA
IITIYSLITYFRAILEVIIGYVIAFIGVTVMISLAPFFIILMLFEKTKSLFDNWISTLLSYVVQPTILLI
FFLLIDQVLSEQLLKVVVRACWDTLIPIKIGLDLTHLGIPLHFSFTLPFLPGIPFYVPDVPEISSSNILT
NNANTFLVLFTTALLFYSYCLMSYSLVTFVNIVVGMLTNVTPARISGNYQERSDPVGAVMQDIDSVTKPI
KKAAMAPSRVFKDKIIDQNYKARKPEVGGEFTNKFLAERNDVKKEEGEKKE
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|229586230|ref|NC_012633.1|:143493-146168 Rickettsia africae ESF-5 chromosome, complete genome
ATGAAAATTCTTAAGAGTTTAGTTTTATTAGTTTTGTTTATGGCGATGCCAGCTAAAGCCGATGATGCTT
TTTCATGGATGTCAACCAGCTTTGGCGGGTTAAAAAGCTTATTCGGTTGTTTAGAAGTGCCTGGATTTAC
AAGTTTTCAAGAGGGTAATATAGGAATTAATTTATCTACAGCCGGACTTTGGCAATCAACAGGTAATACT
GTTCAGAAAGGTAAATTGTTAAAAATAAATTGGTCTACTTCAGGTATTACTTTTGAACCTAGAAAATATC
TAGTATTATATAGAATTGATCCAAGGTTTAGTATGCCGCAAGTTTTCATTAAAACTTATAATTATTCTAA
ATTACAATTTGAAGCTTTAGGATTTCCTCGTTTTGTTACGGACAATAACAGTGAAACACCGGGGACTATA
CCGCCTGATAAAAACCTTGATGCACTTTCATTTACTAAAATGTCTGATTTTGTTAAATATTTTAACTATT
CTAACGGTAATTCGAGAATTGAAGTTAAGGCCGGCGATGTAGTAAATATTAGTTTAGTTGGTAAAGATAA
TTTTTTTAGCCCTAATACTCTAAAACTTCCTAATACCGTAGATAATATTTTAACACAGGAACTTGATAGC
TCGATATTCGCTGCTTCTGCACTTTATACTCAAAGTAACCTTGGAGATTTTGATAATAGAATAATTTACT
CTTCTGCAGAGCAGGTGTGTAATATGATAGATAAGGAAAGAAAAAGTGTATGTAGCGGCACGGGTACTGC
TACAAAGTATAAAAATACCGATAATGGAGTAATAGTCGGTAAGCCTATGATAACAGGAGCGGTACAGTAT
TTCATGGGCTTAATTAAGGCTTGTCCTGCTAATGCCGGTATAAATACTAGCCCTGCTTGCTATTACGATC
AAGGTAGAGGGATGATAATTAAAGTAGGCGGGCAGGTTATTAAGGGACAAGATCAGAGTTTTGTAAATTC
AGGCAGTACTCAAAGTAGTTTTATATATTATCAAGCCACTAGCGGTGGTACTATGGATTTTACTAGCGAT
TGGCAAGTTAGTAACATGTTTAGTAATTCAGTTTTAATGAGTGATTGGAGCCGAAATTTTTCAAATTATG
CTAGTTTTGTAGATTATATAAATAAGAATGATTGGTCAGCTAATTTTTTATATTTTGGTTGTTATTCGAT
GATTGTTGAAATAGGTAATGGGGCAAATTTAATTAATCCTGATGATCAACAAAATATAAAGTTAGAATAT
TTAATAACGTCTGATGGTACATTACCTGATCCATCTGTTCGTGGTATGCCGGTAGATTATAACTTTGCGA
CTGATGCCCCGCAAGATGGATATTTATGGTTAAGGGTGGTAAATCCTAATAGTAATATACAAGGGGTAGT
TAGTGTAAATTATGCTAATTATACCGGTACAACTTGGTTTTCTGATATAATATATAACGGTGCTATTAAA
CCTATTACCGATCAGTTTAGAACTTTTAGTCAAAACTTTTATATTAAGTTAGTTAAAAATTCTGCAGTGC
AGAATTTAGCTAAAACTGCATTAACCCTTTATGTTACTATATTTGGGCTAATGTTCGTTACAGGAGCATT
AAAATTAACTGCCGTAGAAGTAATAACACGTATATGCAAAATAGCTATAGTAGCTTTTTTAATTAGAGAA
GAAAGTTGGAGCTTCTTTAATACATACTTCTTTAGTGCATTTACTGACGGTATTGATTTCTTTGTAACTA
ACGTAGTAGGTGTTACAAGCTCTAGATCTAATATTTTTGGTTTTATTGATCCTATATTTGATAAATATAC
TAACGGTAGGATTTGGGGATTACTATTTATTGAATTATTACAAATACATAATGGTTTAGCATTTATCGCT
ATTATAACCATTTATTCACTTATTACTTATTTTAGAGCTATTTTAGAAGTTATAATAGGTTATGTGATTG
CATTCATAGGGGTAACTGTTATGATTTCATTGGCACCGTTTTTTATAATATTAATGTTATTTGAAAAAAC
TAAAAGTTTATTTGATAATTGGATATCGACATTGCTTAGCTATGTAGTGCAGCCGACAATATTATTGATT
TTCTTTTTATTGATAGATCAGGTTTTATCTGAGCAGCTTTTAAAAGTGGTAGTTAGAGCCTGTTGGGATA
CTCTTATACCAATAAAAATAGGGCTTGATTTAACACATCTTGGTATTCCACTTCATTTCTCTTTTACATT
ACCGTTCTTACCCGGAATACCTTTCTATGTACCGGATGTTCCAGAAATTAGTAGCTCGAATATTCTAACG
AACAATGCTAATACTTTCTTAGTATTATTTACTACGGCTTTATTATTTTATTCATATTGCTTGATGTCAT
ATAGTTTAGTAACTTTTGTAAATATAGTAGTTGGAATGCTTACAAATGTTACACCGGCACGAATATCAGG
AAATTATCAAGAACGTTCTGATCCTGTGGGAGCCGTTATGCAGGATATAGATTCAGTAACAAAACCGATT
AAAAAGGCTGCAATGGCTCCGTCTAGAGTTTTCAAAGACAAGATAATTGATCAAAATTATAAAGCTAGAA
AACCGGAAGTAGGTGGTGAATTTACAAATAAATTTCTTGCTGAGCGTAATGATGTGAAGAAAGAGGAAGG
AGAGAAGAAAGAATAA
 Primer design