SecReT4
Protein ID: 229586348
T4SS name [ID]VirB [480]
Gene symbolvirB6-5
Locus tagRAF_ORF0135
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]146321..149782 [+]
ProductVirB6
Component typeVirB6
UniProt IDC3PME6
KEGG IDraf:RAF_ORF0135
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.6e-24, Aligned region: 293..482
Protein Sequence: 1153 a.a.     [Download]
>gi|229586348|ref|YP_002844849.1| VirB6 [Rickettsia africae ESF-5]
MNKNIFITLLISLLLLSGCTGDTCIDPDDFGFIKFNVSARYDPEEITSRQEGNQVAPWRDSAYKVNGYPL
TIMVRPWSYILGDKNTSGQLSAWCPWYGQKNNTTTLAAFCVKLQPCTFWDNTRLDMCTPNPANQNDAMIS
NAPCIMTNGVGLYFLIAAKNTDPNISPDSQSKPQGITQHLGEELTSGYEFYSTSSTGQFLEAGGINYQYK
GEDKSKYAQSPLYFKIIDKFYNDNSGQYRLVIKSGVTDTRPDPLQFLTDLIKGVLFGKDGIIKKTYQQII
DTSGYRMSVSAILTLYIMFTGFSFLIGNINLTHVELIVRILKVSIVSILLSTDKAWTFFHDYLFVFFIDG
VQQILQIINEASATGPGSQSLLGLLISPQTLSKLFSLLFVDWLGFIYIILYLIALYFIFFLIFKATIIYL
TALITIGMIIIMGPIFICFMLFNITRSLFENWLRQLISYALQPIILFTGIAFISMIIRTEIYSTLGFAVC
KHDFPNLGPINEIFGSFLEDIDPSLGHSIFYWWFPVPMKGGINNFHKANILVPKDHIIVDDSCKNDPDKC
KHCAAYECIDERYIELPFLDLVKDAKRISNFINGKFVQLDGILLIFVSIYLLSKFNDTAMSTAQFIAGTS
GNLTEIQKVNQQSYESAAQQMNRPLNYVAKTVSAPVTSRVSAGKEQVRMFFAEKFENMMMGRLEKQALGS
SANKTVQNEVKRKYGIDSKDVKMNAITDYENGIAGLLKNLPKGNELKAKELSQMKFTQLRDKIAANKYGV
KDYTALSKEQKAELDKSLKDANLRELASDANFTRDYQDAYKNAHQEMSGRGVGLFGKNIGVLRSWQEIKH
RVDTKRKLKEEQRVGIGEKIYAGYTGIKRGALTAIVGKDLRDAYEGNLTSAEWHDFEYNDPRLRTYSEKL
KDDEKAREHEELQMHINKEALAAQADILSPEYLARLEKAGRHSDVEYYQELAQRKLIHEVHGRLFEEGEP
VMMGDRFMCEKATDSQMRDMIDNAHRKYAEFIDGDRYIRRQEHYDIMHEKAQENLEQTYKELKDHFKRDD
IKIEEMPALIAQKVKDTAEGAEIDQKITEELNNFNADVKNYEYSTEVLNKIEDRKQAITDEVNAQIDKIN
KYRENAKMQTYVKPIVNEGRKLRKLEDHLRNMK
 
Nucleotide Sequence: 3462 bp     [Download]
>gi|229586230|ref|NC_012633.1|:146321-149782 Rickettsia africae ESF-5 chromosome, complete genome
ATGAACAAAAATATTTTTATTACATTATTAATATCGCTATTGCTGCTTTCCGGTTGTACCGGCGATACTT
GTATTGACCCTGATGATTTCGGTTTTATCAAATTCAATGTCTCTGCTAGATATGATCCGGAAGAAATTAC
TTCAAGACAGGAAGGTAATCAGGTAGCACCATGGCGTGATAGTGCTTATAAAGTAAACGGCTATCCTTTA
ACCATTATGGTAAGACCGTGGAGTTATATACTTGGCGATAAAAATACTTCAGGTCAGTTATCTGCATGGT
GTCCATGGTATGGTCAAAAAAATAACACAACTACTTTGGCTGCTTTTTGTGTTAAGCTACAACCGTGTAC
TTTTTGGGATAATACTAGACTTGATATGTGTACTCCTAATCCCGCAAATCAAAATGATGCAATGATTAGT
AATGCTCCATGTATAATGACAAACGGTGTCGGGCTTTATTTTCTTATTGCCGCTAAAAATACCGATCCCA
ATATTTCACCGGACTCACAGAGTAAACCGCAAGGTATAACTCAGCATTTAGGAGAGGAGCTTACTTCGGG
CTATGAATTTTATAGTACTAGTAGTACAGGACAATTCTTGGAAGCCGGCGGTATAAATTATCAATATAAA
GGTGAAGATAAGTCAAAATATGCTCAATCTCCTCTTTATTTTAAGATTATAGATAAATTTTATAATGATA
ATAGCGGGCAATATAGATTAGTAATAAAGTCTGGAGTTACTGATACTAGACCCGATCCGCTACAATTTTT
AACGGATTTAATAAAAGGAGTATTATTTGGTAAGGATGGGATTATAAAGAAAACTTATCAACAAATAATT
GATACGTCGGGTTATAGGATGAGTGTCTCGGCTATTTTAACTCTATACATAATGTTTACAGGTTTTTCCT
TTTTAATAGGTAATATAAACCTTACTCATGTCGAACTTATAGTTAGAATATTAAAAGTTAGTATAGTCTC
AATATTATTAAGTACTGATAAAGCTTGGACATTTTTTCATGATTATTTATTCGTATTTTTTATTGATGGG
GTTCAGCAAATACTGCAAATAATTAATGAAGCTTCGGCTACCGGTCCTGGTTCTCAAAGCTTGCTTGGGT
TACTTATTTCTCCTCAAACTTTATCTAAATTATTTTCTTTACTATTTGTTGATTGGCTTGGTTTTATATA
TATCATTCTATATTTAATAGCCTTATATTTTATTTTCTTTCTTATATTTAAAGCCACTATTATCTATCTA
ACCGCTCTTATAACTATCGGGATGATTATAATTATGGGACCGATATTTATTTGTTTCATGTTGTTTAATA
TAACTCGTTCGTTATTTGAGAATTGGTTAAGACAATTAATATCATATGCATTACAGCCTATAATTTTATT
TACCGGTATCGCTTTTATTTCAATGATCATCAGAACCGAAATATATTCAACGCTTGGTTTTGCAGTATGT
AAACATGATTTTCCTAATTTAGGTCCGATAAATGAAATATTCGGTAGCTTCCTTGAGGATATAGATCCAA
GCCTGGGTCATTCAATATTTTATTGGTGGTTTCCAGTACCGATGAAAGGCGGTATAAATAATTTCCACAA
AGCAAATATATTAGTTCCTAAAGATCATATAATAGTAGATGATTCTTGTAAGAATGACCCTGATAAATGT
AAGCATTGTGCTGCGTATGAGTGTATAGATGAACGCTATATTGAATTACCGTTTTTAGATTTAGTTAAAG
ATGCAAAAAGAATTAGTAATTTTATAAATGGGAAATTTGTCCAACTTGACGGGATATTACTAATTTTTGT
GTCTATTTATTTGCTAAGTAAATTTAACGATACTGCTATGTCAACGGCACAATTTATTGCTGGTACTTCA
GGTAATTTAACAGAAATACAAAAAGTTAATCAGCAATCTTATGAATCTGCAGCGCAACAAATGAATAGAC
CGCTAAATTATGTGGCTAAGACGGTAAGTGCACCTGTAACTAGCCGTGTAAGTGCAGGGAAAGAGCAAGT
TCGTATGTTTTTTGCCGAGAAATTTGAAAATATGATGATGGGAAGGCTTGAAAAGCAAGCTCTCGGTTCT
TCAGCAAATAAAACCGTACAAAATGAGGTTAAGAGAAAATACGGTATAGATTCTAAAGATGTAAAAATGA
ATGCTATTACGGATTATGAAAACGGTATTGCAGGATTATTAAAGAATTTACCTAAGGGGAATGAATTAAA
AGCAAAAGAACTATCGCAAATGAAGTTTACTCAGCTTCGAGATAAAATTGCTGCAAATAAATATGGAGTG
AAAGATTACACTGCTTTAAGTAAAGAACAAAAAGCTGAGCTTGATAAGTCATTAAAAGATGCTAACTTAC
GTGAACTCGCTAGCGATGCAAACTTTACTAGAGATTATCAAGATGCTTATAAAAATGCTCACCAAGAAAT
GTCCGGGCGAGGTGTTGGTCTGTTTGGTAAGAATATAGGAGTGCTTAGAAGTTGGCAAGAGATAAAGCAT
CGTGTTGATACAAAACGTAAATTAAAAGAAGAACAGCGTGTAGGTATAGGCGAAAAAATATATGCAGGTT
ATACAGGAATAAAAAGAGGAGCTTTAACTGCAATAGTCGGTAAAGATTTACGTGATGCTTATGAGGGTAA
TCTAACCAGTGCCGAATGGCATGATTTTGAATATAACGATCCAAGGCTTAGAACTTATAGCGAAAAATTA
AAAGATGATGAAAAAGCACGAGAACATGAAGAGCTCCAAATGCATATTAATAAGGAGGCGCTAGCTGCTC
AAGCAGATATATTATCACCGGAATATCTAGCAAGACTAGAAAAAGCAGGTAGACATAGTGATGTGGAATA
TTATCAAGAATTAGCTCAAAGAAAGCTTATTCATGAGGTGCATGGTAGGTTATTTGAGGAAGGTGAACCG
GTAATGATGGGCGACAGATTTATGTGTGAGAAAGCTACTGATTCTCAGATGCGCGATATGATAGATAACG
CTCATAGAAAATATGCAGAATTTATAGATGGAGATCGATATATTCGTCGCCAAGAGCATTATGATATTAT
GCACGAGAAAGCCCAGGAAAATTTAGAGCAAACTTATAAAGAGCTTAAAGATCATTTCAAAAGAGATGAT
ATCAAGATCGAAGAAATGCCGGCATTAATAGCACAAAAAGTTAAAGATACCGCCGAGGGAGCTGAAATAG
ACCAAAAGATTACAGAAGAGCTTAATAACTTTAATGCTGATGTTAAAAATTATGAATATAGTACTGAAGT
ATTAAATAAAATAGAGGATAGAAAGCAAGCCATTACCGATGAAGTCAATGCTCAGATCGATAAGATTAAT
AAATATAGAGAAAATGCCAAAATGCAAACCTATGTAAAGCCTATAGTAAACGAGGGTAGAAAGCTAAGAA
AATTAGAAGATCATTTAAGAAATATGAAGTAG
 Primer design