SecReT4
Protein ID: 229586436
T4SS name [ID]VirB [480]
Gene symbolvirB2
Locus tagRAF_ORF0232
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]253513..253869 [+]
ProductVirB2-like protein
Component typeVirB2
UniProt IDC3PMN4
KEGG IDraf:RAF_ORF0232
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-18, Aligned region: 15..105
Protein Sequence: 118 a.a.     [Download]
>gi|229586436|ref|YP_002844937.1| VirB2-like protein [Rickettsia africae ESF-5]
MNFPIRKLNEELIDYNLSLRILFTILSMAIIMVAFDSLGSNGDPVGDALCKLIKVFRGNTAKGIAVVGII
VLGIQTLRGKLQWEVALVVVTAIIILFKAPDIVNMVSSDTNSSSCGVS
 
Nucleotide Sequence: 357 bp     [Download]
>gi|229586230|ref|NC_012633.1|:253513-253869 Rickettsia africae ESF-5 chromosome, complete genome
ATGAACTTTCCTATTCGTAAATTAAACGAAGAATTAATCGATTATAATCTATCATTACGCATATTATTTA
CTATTCTAAGCATGGCTATTATTATGGTAGCTTTTGATAGCTTAGGTAGTAATGGCGATCCTGTAGGTGA
CGCATTATGTAAGTTAATTAAAGTATTCAGAGGCAATACTGCAAAAGGTATAGCTGTTGTCGGTATAATT
GTTCTGGGAATTCAAACATTAAGAGGAAAATTGCAGTGGGAAGTAGCTTTAGTGGTAGTTACTGCAATCA
TTATATTATTTAAAGCTCCAGATATTGTTAATATGGTATCAAGTGATACTAATAGCTCAAGTTGTGGTGT
TTCCTAA
 Primer design