SecReT4
Protein ID: 229586537
T4SS name [ID]VirB [480]
Gene symbolvirB9-1
Locus tagRAF_ORF0358
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]386272..387024 [-]
ProductVirB9
Component typeVirB9
UniProt IDC3PMY5
KEGG IDraf:RAF_ORF0358
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-61, Aligned region: 29..245
Protein Sequence: 250 a.a.     [Download]
>gi|229586537|ref|YP_002845038.1| VirB9 [Rickettsia africae ESF-5]
MKQLIIFCTFIILTLDVFALTISRPLGRDPRLRVMTYNPDDVFKFTGYYGYQASIELARDEEIVSISMGD
TTSWQIVPAGHRIFIKPMEPDATTNMTLITNKRTYFFELYAAETLDMRDPEMVFNVKFLYPDDENDNMSG
HMQTFSAALASPDLTHPEKYNFNYYISGSEEIAPIKIFDDGEFTYLQFRDKNAEISGIFAVDDSLRESLV
NYRLAQDNPNMVILEQVFPKLAIRKGKKVTCVFNQSFKAY
 
Nucleotide Sequence: 753 bp     [Download]
>gi|229586230|ref|NC_012633.1|:c387024-386272 Rickettsia africae ESF-5 chromosome, complete genome
ATGAAGCAACTAATAATATTTTGTACTTTTATAATACTTACATTAGATGTATTTGCTCTTACTATATCAC
GACCTCTAGGTCGAGACCCACGTCTAAGAGTTATGACTTATAACCCTGACGATGTTTTCAAATTCACAGG
ATATTACGGCTATCAAGCAAGTATAGAACTAGCAAGAGACGAGGAAATAGTAAGTATTTCTATGGGAGAT
ACTACTTCATGGCAAATAGTACCTGCCGGTCATAGGATTTTTATTAAACCGATGGAACCGGATGCTACTA
CTAATATGACTTTAATTACTAATAAACGGACGTACTTCTTTGAACTATATGCCGCCGAAACTCTTGATAT
GCGTGATCCTGAAATGGTCTTTAACGTAAAGTTTCTTTATCCGGATGACGAAAATGACAATATGAGCGGT
CATATGCAAACTTTTTCTGCTGCCCTAGCAAGTCCCGACCTGACTCATCCTGAAAAATATAACTTTAATT
ACTATATTAGCGGCAGCGAAGAAATAGCTCCTATTAAAATTTTTGATGACGGCGAGTTTACTTATCTGCA
ATTTAGAGATAAAAACGCTGAAATTTCCGGTATTTTTGCTGTAGATGATTCACTTCGAGAATCTTTAGTA
AATTATCGCCTTGCTCAAGATAATCCTAATATGGTGATCCTTGAACAGGTTTTTCCTAAGCTCGCTATAC
GTAAGGGCAAAAAAGTCACATGCGTATTTAATCAGTCTTTCAAAGCGTATTAA
 Primer design

Protein ID: 229586541
T4SS name [ID]VirB [480]
Gene symbolvirB9-2
Locus tagRAF_ORF0362
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]389132..389605 [+]
ProductVirB9
Component typeVirB9
UniProt IDC3PMY9
KEGG IDraf:RAF_ORF0362
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.9e-32, Aligned region: 45..150
Protein Sequence: 157 a.a.     [Download]
>gi|229586541|ref|YP_002845042.1| VirB9 [Rickettsia africae ESF-5]
MTIVRFYFLVFILLSGFTVQRECSLVDDPCNSSNNYVDDLSITKDNRIKTYIYNPNEVYLLVLHFGFQSH
IEFAKNEEVQNIILGDAYAWKITPLANRLFIKPLEKDIRTNMTIITNKRIYEFDIASTELMMGNERDLVY
VIKFYYPKKNSNYIARF
 
Nucleotide Sequence: 474 bp     [Download]
>gi|229586230|ref|NC_012633.1|:389132-389605 Rickettsia africae ESF-5 chromosome, complete genome
ATGACAATAGTTAGATTTTATTTTTTAGTTTTTATATTATTAAGCGGTTTTACAGTACAACGAGAATGTT
CACTTGTAGATGATCCATGTAATAGTAGTAATAATTATGTAGATGATTTATCTATAACTAAAGATAATAG
GATAAAAACTTATATATATAATCCAAATGAAGTTTATTTATTAGTTTTGCATTTTGGCTTTCAATCGCAT
ATAGAATTTGCTAAAAACGAAGAAGTCCAAAATATAATTCTTGGGGATGCTTATGCTTGGAAAATAACTC
CTTTGGCAAATAGATTATTTATTAAGCCTCTTGAAAAAGATATTCGTACAAATATGACTATTATAACTAA
TAAAAGAATATATGAATTTGATATCGCTTCTACGGAACTTATGATGGGTAACGAAAGGGATTTAGTATAT
GTAATTAAATTTTACTACCCTAAGAAAAATAGTAATTATATAGCAAGATTTTAA
 Primer design