SecReT4
Protein ID: 229586538
T4SS name [ID]VirB [480]
Gene symbolvirB8-1
Locus tagRAF_ORF0359
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]387026..387724 [-]
Productvirulence protein
Component typeVirB8
UniProt IDC3PMY6
KEGG IDraf:RAF_ORF0359
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.2e-18, Aligned region: 21..222
Protein Sequence: 232 a.a.     [Download]
>gi|229586538|ref|YP_002845039.1| virulence protein [Rickettsia africae ESF-5]
MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPLSHRSLLLLICTIFTLLLTLICISINILLPINKKVNYL
IKDDAEKQAAVTNTKHSTLVKPYISIANIMLQNYVNQREEYNYDILKEQFTFIKNASTSIVYMQFANFMN
IDNPLSPVIRYQKLYRRSINILSINNINDNEAVVTFESLAKNSTDAILENMVWEARIGFIMDSISTNTSP
NMPFNFTVTSYKLKLLRNKNQK
 
Nucleotide Sequence: 699 bp     [Download]
>gi|229586230|ref|NC_012633.1|:c387724-387026 Rickettsia africae ESF-5 chromosome, complete genome
ATGGACCCATTAACCAACGCAATACAAGAATATATAAAATCCGGCGAATATTTTATTGATGCAAGAAAAT
GGTATAATTTTAAGTATATCTTACCGTTAAGTCATAGAAGTCTTCTGCTTTTAATATGCACGATTTTTAC
CTTATTATTAACCTTAATTTGTATAAGTATCAACATATTGCTACCTATAAACAAAAAAGTAAATTATTTA
ATAAAAGATGATGCCGAAAAACAAGCTGCCGTTACTAATACTAAACATTCAACATTAGTAAAGCCTTATA
TCTCTATTGCAAATATTATGCTTCAGAATTATGTAAACCAACGAGAAGAATACAATTACGATATATTAAA
AGAACAATTTACCTTTATCAAAAATGCTTCTACGAGTATTGTTTATATGCAATTTGCTAATTTTATGAAT
ATTGATAACCCATTATCACCGGTCATAAGATATCAAAAACTATATAGACGCTCAATTAATATATTATCAA
TTAACAATATAAACGATAACGAGGCAGTTGTTACTTTTGAATCATTGGCAAAAAATAGTACGGATGCAAT
TTTAGAAAATATGGTATGGGAAGCAAGAATCGGATTTATAATGGATTCTATCAGTACAAATACATCACCT
AATATGCCGTTCAATTTTACCGTTACTAGTTACAAGCTAAAGTTACTAAGAAATAAAAATCAGAAATAA
 Primer design

Protein ID: 229586540
T4SS name [ID]VirB [480]
Gene symbolvirB8-2
Locus tagRAF_ORF0361
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]388414..389145 [+]
Productvirulence protein
Component typeVirB8
UniProt IDC3PMY8
KEGG IDraf:RAF_ORF0361
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.7e-45, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|229586540|ref|YP_002845041.1| virulence protein [Rickettsia africae ESF-5]
MNNIFGFFKSSNNSQSGAGDTQTQESITSANPLKITQNWYEERSDKLLVQRNLLIILIILLTIFMVIATL
VIAFVVKSKQFEPFVIQLNSNTGRASVVEPISSPVLTADESLTRYFIKKYITARETYNPVDFATIARTTI
RLFSTSSVYYNYLGYIRNKDFDPTLKYKEENTTFLVIKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVV
SYAYVPMQLTDSELDINPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|229586230|ref|NC_012633.1|:388414-389145 Rickettsia africae ESF-5 chromosome, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAATAACTCGCAAAGCGGTGCAGGAGATACACAAACGC
AAGAAAGTATTACATCGGCTAATCCTTTAAAAATTACTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
ACTTGTTCAACGTAACTTACTTATCATATTAATAATACTACTAACCATTTTTATGGTTATAGCAACTTTA
GTAATAGCCTTTGTAGTGAAATCTAAACAGTTTGAGCCTTTTGTTATTCAGCTTAATAGTAATACCGGAC
GTGCCTCAGTGGTAGAACCTATTTCATCACCAGTGTTAACGGCGGATGAGTCTCTTACAAGGTATTTTAT
AAAGAAATACATAACGGCACGGGAAACATATAATCCAGTTGATTTTGCGACGATAGCTCGTACGACAATA
AGATTATTTTCAACAAGCAGTGTTTATTACAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CTTTAAAATATAAAGAAGAGAATACTACATTTTTAGTAATAAAATCATGGTCAAAAATCGCAGCAGATAA
ATATATAGTTAGATTTTCCGTAAATGAAACATCAGGAAACCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGCTTATGTGCCTATGCAATTAACAGATTCAGAACTTGATATAAATCCGGTAGGGTTTCAAGTGA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design