SecReT4
Protein ID: 229586542
T4SS name [ID]VirB [480]
Gene symbolvirB10
Locus tagRAF_ORF0363
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]389789..391237 [+]
ProductVirB10
Component typeVirB10
UniProt IDC3PMZ0
KEGG IDraf:RAF_ORF0363
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.2e-36, Aligned region: 191..353
TrbI [PF03743], Evalue: 1.2e-36, Aligned region: 401..470
Protein Sequence: 482 a.a.     [Download]
>gi|229586542|ref|YP_002845043.1| VirB10 [Rickettsia africae ESF-5]
MAEEQNNNHNTGSLSGVDSPEVQRELSKVSVSFNKSIVIVVVICGIFIYIFYTLFFGTAKEEIPETQIPS
NIVKPVTEVDDNIPEIPKLPDPPKLETPTAPPPPPPSVVKVPPVLPPTTPVEENKDKTLPLPPVSLPSTS
GTLVESNAEGQRREAKRKSAIVLIGGVEPKKTPEQITAETTFKDRGDMSLVLGRGKLIDAVLETAINSDL
GGEIRAIISRDVFSEKDKVILIPKGSKIFGKYATSTSSDSYGRVSIIWDRIDLTSGYTIEFDSPAVDNLG
RPGLQGRVDNKYKEQFANAVLQSGFNIGLAKVLDKLVPPPIASQAAATNSATAKQLLNTAQTIASNTAMD
ANTRIVTICTNILAAITDKTSTAYTTMTQACTTAQTASSANTAEQRLQTLVQAVNTAASSLLTTTSIAST
PTQAQQASTQAFTDVTNVVKNMITQQQFKPTTTVNQGTPVRIYVNKDYKFPKAVLLKSKVMK
 
Nucleotide Sequence: 1449 bp     [Download]
>gi|229586230|ref|NC_012633.1|:389789-391237 Rickettsia africae ESF-5 chromosome, complete genome
ATGGCTGAAGAGCAAAATAACAATCATAATACCGGTTCTTTATCAGGAGTAGATTCTCCTGAAGTACAAA
GAGAATTATCAAAAGTTTCGGTTAGCTTTAATAAGAGTATTGTGATAGTAGTAGTAATTTGTGGTATTTT
TATATATATTTTTTATACTCTTTTTTTCGGTACTGCAAAAGAAGAAATACCGGAGACTCAGATACCGAGT
AATATTGTAAAACCTGTTACGGAGGTTGATGATAATATTCCGGAGATTCCAAAGTTACCTGATCCGCCTA
AGCTTGAGACGCCCACCGCTCCTCCACCGCCTCCTCCTTCGGTAGTAAAAGTTCCACCGGTCTTACCTCC
TACTACTCCTGTAGAAGAGAATAAAGACAAAACGCTTCCATTGCCGCCGGTTTCATTGCCTTCGACTTCA
GGAACGTTAGTTGAGAGCAATGCAGAGGGGCAACGTCGTGAAGCAAAAAGAAAATCAGCTATAGTGTTAA
TTGGTGGTGTAGAGCCTAAAAAAACACCGGAACAGATTACGGCAGAAACGACCTTTAAAGATCGCGGTGA
TATGTCTTTGGTTCTCGGACGCGGTAAATTAATTGATGCAGTTCTTGAGACGGCAATAAATAGTGATCTC
GGCGGTGAAATAAGAGCCATTATTAGTAGAGACGTATTTTCTGAGAAAGATAAAGTGATATTGATACCGA
AAGGGTCAAAAATATTCGGTAAATATGCAACCTCAACTTCGTCCGATAGTTATGGTAGAGTTTCTATAAT
ATGGGATAGAATCGATTTAACGAGCGGTTATACTATAGAATTCGACTCACCTGCAGTTGATAATTTAGGT
AGACCGGGATTACAAGGAAGAGTTGATAATAAATATAAAGAACAATTTGCAAATGCCGTATTACAATCCG
GCTTTAATATAGGGCTTGCTAAAGTGCTTGATAAGTTAGTGCCGCCTCCTATAGCTTCTCAGGCAGCGGC
TACCAATAGTGCTACGGCAAAACAATTGTTAAATACTGCTCAAACTATTGCGTCTAATACCGCTATGGAT
GCAAATACTAGGATAGTTACAATTTGTACTAATATACTTGCTGCTATTACCGATAAAACTTCGACTGCTT
ATACTACTATGACTCAAGCATGTACAACCGCACAAACTGCTTCTTCAGCGAATACTGCTGAGCAGAGACT
TCAAACCTTAGTACAGGCAGTTAATACGGCAGCTTCAAGTTTGCTTACTACTACCTCTATAGCATCAACT
CCGACTCAAGCACAACAAGCTTCTACTCAAGCTTTTACGGATGTAACGAATGTTGTAAAAAATATGATAA
CTCAGCAGCAGTTTAAGCCGACGACAACGGTTAATCAAGGTACGCCGGTTAGAATATACGTTAATAAGGA
TTATAAATTCCCAAAAGCCGTTTTATTAAAATCGAAGGTAATGAAATGA
 Primer design