SecReT4
Protein ID: 229586543
T4SS name [ID]VirB [480]
Gene symbolvirB11
Locus tagRAF_ORF0364
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]391234..392238 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDC3PMZ1
KEGG IDraf:RAF_ORF0364
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.7e-94, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|229586543|ref|YP_002845044.1| type IV secretion system ATPase VirB11 [Rickettsia africae ESF-5]
MSEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYSKQIPELDSEHLLALGSLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYAIRKPSGMNLTLDEYAKMGAFDDTATESLVDEDAVIL
NNFLAEKKIKEFIRHAVVSKKNIIISGGTSTGKTTFTNAALTEIPAIERLITVEDAREVVLSRHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSSGKRYVSEVYYKKNKNAEGMV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|229586230|ref|NC_012633.1|:391234-392238 Rickettsia africae ESF-5 chromosome, complete genome
ATGAGTGAAGAATTTGCAGCCTTAGAGACGTTTTTACTTCCTTTTAAAAATTTATTTGCTGAAGACGGTA
TTAACGAAATTATGGTTAATAAGCCCGGAGAAGTATGGGTTGAAAAAAAAGGTGATATATATTCTAAGCA
AATACCGGAACTGGATAGCGAACATCTACTTGCATTAGGGAGTTTAGTCGCTCAATCTACCGAACAGATG
ATTTCAGAAGAAAAACCGCTTCTTTCGGCAACTTTGCCGAATGGCTACCGTATTCAAATAGTATTTCCTC
CTGCTTGTGAGATAGGACAAATCATTTATGCTATAAGAAAGCCTAGCGGTATGAATCTAACTTTAGATGA
ATATGCTAAAATGGGGGCATTTGATGATACTGCAACAGAGAGTTTAGTAGATGAAGATGCAGTAATTTTA
AATAATTTCTTAGCTGAAAAAAAGATTAAAGAATTTATTAGACATGCAGTTGTTTCAAAGAAAAATATCA
TAATTAGCGGCGGTACTTCAACCGGTAAAACTACTTTTACTAATGCGGCACTCACTGAAATACCTGCAAT
AGAAAGATTAATTACTGTAGAAGATGCTCGTGAGGTTGTGCTATCACGCCATCCTAACAGAGTGCATTTA
CTGGCTTCCAAAGGAGGACAGGGGCGTGCAAATGTTACTACTCAAGATTTAATAGAGGCCTGTTTGCGTT
TAAGACCAGATAGGATTATAGTAGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACAGGTCATCCCGGTTCAATATCAACACTGCATGCTGATAGTCCCGCTATGGCTATTGAGCAGTTAAAG
CTTATGGTTATGCAAGCAGATCTTGGTATGCCGCCTGAAGAAGTAAAGAAGTATATTTTAACCGTTGTAG
ATATCGTTGTGCAGTTAAAACGCGGTAGCAGCGGGAAAAGATATGTTTCGGAAGTATATTATAAGAAGAA
CAAGAATGCTGAGGGGATGGTTTAA
 Primer design