SecReT4
Protein ID: 229586544
T4SS name [ID]VirB [480]
Gene symbolvirD4
Locus tagRAF_ORF0365
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]392393..394168 [+]
Producttype IV secretion system protein VirB8
Component typeVirD4
UniProt IDC3PMZ2
KEGG IDraf:RAF_ORF0365
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-165, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 9e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 1.3e-21, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 2.6e-05, Aligned region: 155..481
Protein Sequence: 591 a.a.     [Download]
>gi|229586544|ref|YP_002845045.1| type IV secretion system protein VirB8 [Rickettsia africae ESF-5]
MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGAFVAIFTNEVGALGVNINAINIAYKWAYWLINVWGQLK
ITDYNYLKLKLLASLLSPVIIVIIFYIKNFERIKSLQFFKQDEKVYGDASWANPSDIEAAGLRSKKGMLI
GVDAGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWE
PSNPDGVTHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNATYRITFAANNYETANLISQLVGNKTVEQRS
FSKPLFFDLNIATRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPT
FVPTQVPFDPRANNNGASEETETITVPENNE
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|229586230|ref|NC_012633.1|:392393-394168 Rickettsia africae ESF-5 chromosome, complete genome
ATGGAATGGCATAAGATACTTAAAGTTACTAGAAATATATTCGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTTGTACCATTTGGATAAGCGGTGCATTTGTTGCAATTTTTACTAATGAGGTTGGAGCTTTAGGTGT
AAATATAAATGCTATAAATATTGCTTATAAGTGGGCTTATTGGCTTATTAACGTTTGGGGGCAGTTAAAA
ATTACCGACTATAATTATTTAAAATTGAAGCTACTTGCCTCTCTTCTCAGTCCGGTTATTATTGTTATAA
TATTTTACATTAAAAATTTTGAAAGAATAAAATCATTACAATTTTTCAAACAAGATGAAAAAGTATATGG
AGATGCAAGCTGGGCTAATCCGTCAGATATAGAGGCTGCAGGTCTTAGATCTAAGAAAGGTATGCTGATC
GGTGTTGATGCCGGTGGATATTTTGTTGCAGACGGGTTCCAGCATGCTTTATTATTTGCTCCTACCGGTT
CAGGTAAAGGTGTAGGGTTTGTGATACCTAATTTGTTATTTTGGAGTGATTCGGTAGTAGTGCATGACAT
AAAGCTTGAAAATCACGGGTTGACAAGTGGTTGGCGTGAGAAGCAAGGGCAGAAAGTTTTTGTATGGGAG
CCTTCTAATCCTGATGGTGTTACTCATTGTTATAATCCGATTGATTGGGTTAGTACTAAGCCTGGGCAAA
TGGTTGATGACGTTCAAAAAATTTCAAATCTTATAATGCCGGAAAAGGATTTTTGGAATAATGAGGCACG
AAGCTTATTTTTAGGTGTAACTCTATATTTAATAGCCGATCCTACTAAAACTAAATCTTTCGGTGAAGTA
GTGCGTACTATGAGGAGTGACGACGTAGTTTATAATCTAGCGGTCGTACTCGATACGCTTGGTGGTGTAA
TACATCCTGTTGCATATATGAATATTGCTGCATTTTTGCAAAAAGCCGATAAAGAGCGTTCCGGCGTAAT
ATCTACAATGAACTCATCGCTTGAATTATGGGCAAATCCACTGATTGATTCAGCTACAGCATCTTCTGAT
TTCAATATACAAGAATTTAAAAAAGTCAAAACAACCGTATATGTAGGGTTAACACCCGATAATATACAGC
GTTTACAAAAATTAATGCAGGTGTTTTATCAGCAGGCGACAGAATTTTTAAGCCGCAAAATGCCGGATTT
AAAGGAAGAGCCGTATGGAGTAATGTTCTTACTTGACGAGTTCCCGACGCTCGGGAAGATGGATACTTTT
AAAGCCGGTATAGCTTATTTTAGAGGTTATAGAGTTCGTTTATTTTTAATTATCCAAGATACACAGCAGT
TAAAAGGAACATACGAAGATGCAGGGATGAATTCTTTCTTATCTAATGCAACATATCGTATTACTTTTGC
CGCTAATAACTATGAAACGGCAAATTTAATATCGCAGCTTGTCGGTAATAAGACGGTAGAACAAAGATCA
TTTAGTAAACCTTTATTTTTTGATCTTAATATTGCTACTAGAACCCAAAACGTTTCTCAGGTTCAAAGAG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCGAGAGATGAGCAAATTGTTTTAATAGAATCCTTTCC
GCCTATAAAATCGCGTAAAATTAAGTATTATGAAGATAAGTTTTTTACTAGTAGATTATTACCGCCGACT
TTTGTACCTACTCAAGTACCTTTTGACCCTAGGGCAAATAATAATGGGGCTTCGGAAGAGACCGAAACAA
TAACTGTTCCGGAAAATAATGAGTAA
 Primer design