SecReT4
Protein ID: 229587146
T4SS name [ID]VirB [480]
Gene symbolvirB4-2
Locus tagRAF_ORF1109
StrainRickettsia africae ESF-5
Repliconchromosome [GenBank: NC_012633] [Browse all T4SS(s) in this replicon]
Location [Strand]1127518..1129950 [+]
ProductVirB4
Component typeVirB4
UniProt IDC3PLR4
KEGG IDraf:RAF_ORF1109
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 4.4e-51, Aligned region: 183..383
AAA_10 [PF12846], Evalue: 4.4e-11, Aligned region: 436..605
Protein Sequence: 810 a.a.     [Download]
>gi|229587146|ref|YP_002845647.1| VirB4 [Rickettsia africae ESF-5]
MFSGLRKFDKDLYNYKAPNFIPIACHYNENTLLTKDGKLLQIIKIHGITSEKISDNIQNLREMVRVSITK
NITDYDFAFWLHTIREKQNLDDSTPYKKLLPANIHTLWQRKNHWNNKFVNTLYISIVHDSTKVNITNFNS
LINSLSHKLITDFENNYLDSAFQKLDNITNNILNDLNEFSAEKLGIIFENDNVFSNPLFLYNRIANLNNN
DCLIPIIDLSDAIGRSIYTISSDKMVVTDHEKNNKFVSLLSIKEYHETPSNTLDKFLQLPIELIITEIFY
FVSKKQVISKLHGQDYILKITNDSTLLNHKGINKLDAANLDFQFCNQQISIAVIEEDENKLDAAVAKAST
ELFKLGIIHVKEDINIEQIFWSQLPANFAFIRRMSPLSVEHIASLTALHNTTLGNQYNPWGKAITLLRTE
KGTPYFMNFHDKTNKGNTCIFGTGKTGKTVLLNFLISEATKYDPTIIYISNNNDSKIFIEAIEGKWLEPD
KQIINPFLVDDTEKSQAFILEFLKLISGHYISPLSEIEISFLEKLKNKILSIEKEKRIFSDILKLEDFKE
EGGIQILDKLKVFTEEQLYSGLFDGSSLNIEEGKVIGFNLYKLSDEPFSKQFYPTERKFLEQFNNNLKKH
QSISAAVIYAFTYHLSLVGTKPKIFAADNFDKLYRPEIYYDNINLIYNNLSQNNGIFVSNFNFIYLKSYP
KYTIKPWLDLINTKIILPSDVKIEDLDKILGLSKPEIRKLSQLILSARMFLISKDNESIASELSIAALIG
VVRILSSRQEEMDIYKKILEQHQGPPDNWVNYLYNELNTD
 
Nucleotide Sequence: 2433 bp     [Download]
>gi|229586230|ref|NC_012633.1|:1127518-1129950 Rickettsia africae ESF-5 chromosome, complete genome
GTGTTTAGTGGTTTACGAAAATTTGATAAAGATCTATATAATTATAAGGCTCCTAATTTTATACCTATAG
CATGTCATTATAATGAAAATACTTTACTTACCAAAGACGGTAAATTACTACAAATTATTAAAATACACGG
CATTACCTCAGAGAAAATAAGCGATAACATACAAAATTTACGTGAAATGGTTAGAGTTTCTATAACAAAG
AATATAACCGATTATGATTTTGCTTTTTGGCTACATACAATACGAGAAAAACAAAACTTAGACGATTCAA
CTCCTTACAAAAAATTATTACCGGCAAATATTCATACCTTATGGCAAAGAAAAAACCATTGGAATAATAA
ATTCGTTAATACTTTATATATATCTATAGTACATGATTCTACTAAAGTTAACATCACAAATTTTAACTCT
TTAATAAATTCTTTATCTCATAAATTAATTACTGATTTTGAAAATAACTACTTAGATTCAGCTTTTCAAA
AATTAGACAATATCACTAATAATATTTTAAATGATTTAAACGAATTCAGTGCTGAAAAACTCGGTATAAT
ATTTGAAAATGATAATGTTTTTTCTAATCCTTTATTTTTATATAATCGCATAGCTAACCTTAATAATAAT
GATTGTTTGATACCTATAATAGATTTATCCGATGCAATAGGTAGAAGTATTTATACAATTAGCAGCGATA
AAATGGTAGTTACGGATCATGAGAAAAATAATAAATTCGTTTCTTTACTATCTATAAAAGAATATCATGA
AACTCCTTCTAATACACTGGATAAATTTTTACAGTTACCGATTGAATTAATAATAACTGAAATATTTTAC
TTTGTTAGCAAAAAACAAGTAATATCCAAATTGCATGGTCAAGATTATATTCTAAAAATTACTAACGACT
CAACTTTACTTAATCACAAAGGGATTAATAAGCTTGATGCAGCTAATTTAGATTTTCAATTTTGTAATCA
GCAAATTTCAATTGCCGTTATAGAAGAAGATGAAAATAAACTAGATGCAGCCGTAGCTAAAGCATCAACC
GAACTTTTTAAACTTGGTATTATTCATGTAAAAGAAGATATTAATATTGAGCAAATATTTTGGTCGCAAT
TACCTGCTAACTTTGCCTTTATACGTAGAATGTCGCCATTATCCGTAGAGCATATTGCTTCTCTTACCGC
TCTTCATAATACTACACTCGGTAATCAATATAATCCTTGGGGTAAGGCTATAACTTTACTGCGAACCGAG
AAAGGTACTCCATATTTCATGAATTTTCATGATAAAACGAATAAAGGCAATACTTGCATCTTTGGTACGG
GGAAAACCGGCAAAACCGTATTATTGAACTTTTTAATATCAGAAGCGACTAAATACGATCCAACAATAAT
TTATATCTCTAATAATAATGATTCTAAAATTTTTATCGAGGCAATAGAAGGCAAATGGTTAGAACCGGAC
AAACAAATTATCAATCCATTTTTAGTAGATGATACAGAAAAATCACAAGCATTCATTTTAGAATTTTTAA
AATTAATCAGTGGTCATTATATTTCACCTCTTAGCGAAATAGAGATATCCTTTCTAGAGAAATTAAAAAA
TAAAATTTTATCAATTGAAAAAGAAAAACGTATTTTTTCCGATATTTTAAAATTAGAAGATTTTAAGGAG
GAAGGAGGAATACAAATACTTGATAAACTTAAAGTTTTTACCGAAGAACAATTATATTCCGGATTATTTG
ACGGATCGTCTCTTAACATTGAAGAAGGGAAAGTTATAGGGTTTAATTTATATAAACTTTCTGATGAGCC
GTTTTCTAAACAATTTTACCCGACGGAGAGAAAATTTTTAGAACAATTTAATAATAATTTAAAGAAACAC
CAAAGTATTAGTGCAGCAGTAATTTATGCTTTTACTTATCATTTAAGTCTAGTTGGCACAAAACCTAAAA
TATTTGCTGCCGATAATTTTGATAAACTTTACAGACCTGAGATTTATTATGATAATATAAATTTAATCTA
TAATAATTTGTCTCAAAATAACGGTATTTTCGTCAGTAATTTCAATTTTATTTATCTTAAGTCATATCCA
AAATATACTATAAAACCTTGGCTTGATTTAATTAATACTAAAATTATTCTACCATCTGACGTTAAAATAG
AAGATTTAGATAAAATTTTAGGTTTAAGCAAACCGGAAATACGAAAATTATCACAGCTAATACTTTCTGC
AAGAATGTTCTTAATTAGTAAGGATAATGAATCGATAGCTTCTGAATTAAGTATTGCCGCTTTAATAGGA
GTTGTCCGTATTTTATCAAGCAGACAGGAGGAAATGGATATTTATAAAAAAATACTTGAACAACACCAAG
GTCCTCCAGATAATTGGGTTAATTACCTATATAATGAGTTAAATACGGACTAA
 Primer design