SecReT4
Protein ID: 229589437
T4SS name [ID]Tfc [754]
Gene symbol-
Locus tagPFLU1922
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T4SS(s) in this replicon]
Location [Strand]2098330..2099712 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDC3K5N8
KEGG IDpfs:PFLU1922
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 460 a.a.     [Download]
>gi|229589437|ref|YP_002871556.1| hypothetical protein PFLU1922 [Pseudomonas fluorescens SBW25]
MSRLLARPWLAVEGLLLCGLFAMATHAHAAEGDYRLGTQGEVLDDRVMYTIGGGSAVGSPSSLYRPSALG
VGGSWRANMMCGNMSLTNTLQNQLNGVTEGFQQIMGSIVQNATQAVMSLPALIIQRANPGLYELLSNGVM
QGRIDFDRSKLTCQAMAEKMADKVGQAGWGALAKNQEMQGNLEQTGGDAVAAVKHTETHNGNNGVSWVGG
SKAGGSGQTPIRVTSDVVRAGYNLLHNRSADDSASISSNDCLGGAICQTWTSPQEESEWAVRVLGETEVA
TCDSCETLRATAGSGLTPLIQEAYSERLKALQGLLSGSLPPTPDNLAKASSPMLPVTRGVIEALRDDPDQ
DLLTRRLASETALSSVLDKALLLLRTLLAGSYEPNIASAEPAQTALTKNIDTLEREIRLLQTELQVRQML
ATNTASLVLDRHAGGADASRAVEQGDPEPGRLNDADARRK
 
Nucleotide Sequence: 1383 bp     [Download]
>ref|NC_012660.1|:c2099712-2098330 hypothetical protein PFLU1922 [Pseudomonas fluorescens SBW25]
ATGAGTCGGCTTCTCGCGCGACCATGGCTTGCCGTGGAGGGCCTGCTGCTCTGTGGATTGTTCGCCATGG
CCACTCATGCCCACGCTGCTGAAGGTGATTACCGCCTGGGCACCCAGGGCGAAGTACTCGACGACCGGGT
GATGTACACCATTGGTGGCGGCTCGGCAGTCGGCTCACCGAGTTCGCTCTACCGACCCAGTGCTCTTGGT
GTCGGTGGGTCATGGCGAGCGAACATGATGTGCGGAAACATGAGCCTCACCAACACCCTGCAAAACCAGT
TGAACGGCGTCACCGAAGGTTTCCAGCAGATCATGGGCAGCATCGTGCAGAACGCGACCCAAGCCGTGAT
GTCGCTACCGGCGTTGATCATCCAGCGCGCCAACCCCGGCCTCTATGAGTTGCTCAGTAACGGGGTGATG
CAAGGCCGTATCGACTTCGACCGCTCCAAGCTGACCTGCCAGGCCATGGCCGAGAAGATGGCGGACAAGG
TCGGTCAAGCCGGCTGGGGCGCGCTGGCCAAGAACCAAGAAATGCAGGGCAATCTGGAGCAAACCGGCGG
TGATGCGGTGGCTGCGGTAAAACATACCGAGACCCATAACGGCAACAATGGGGTGTCTTGGGTCGGCGGC
TCAAAGGCTGGAGGTAGTGGGCAGACACCCATTCGAGTGACCTCCGACGTAGTGCGAGCAGGCTACAACC
TGCTGCATAACCGGTCGGCGGATGACAGTGCCTCGATCAGTAGCAACGACTGCCTGGGTGGGGCCATTTG
CCAGACTTGGACCTCGCCCCAGGAAGAGTCCGAATGGGCAGTTCGCGTGTTGGGCGAGACCGAAGTCGCA
ACCTGCGACAGCTGCGAAACCCTGCGTGCGACCGCTGGCAGCGGACTGACGCCGCTGATTCAGGAGGCCT
ACAGCGAACGCCTCAAGGCCCTGCAAGGGCTGCTGTCGGGCTCACTGCCGCCTACCCCTGACAACCTGGC
TAAAGCCTCGAGCCCGATGCTGCCGGTGACCCGTGGCGTGATTGAAGCCCTGCGCGATGACCCCGACCAG
GATCTGCTGACACGACGCCTGGCCAGCGAGACGGCCCTATCCAGCGTACTCGACAAGGCACTGCTGCTAC
TGCGTACGCTACTGGCGGGCAGTTACGAACCGAACATCGCCTCCGCCGAGCCGGCCCAGACCGCCTTGAC
GAAAAACATCGACACACTGGAGCGCGAAATACGCCTGCTGCAGACCGAACTGCAGGTCCGGCAGATGTTG
GCCACCAACACCGCCAGCCTGGTGCTCGATCGGCATGCCGGTGGTGCCGATGCTTCGCGTGCCGTCGAGC
AAGGCGACCCCGAGCCCGGTCGACTCAATGACGCTGACGCCCGGCGTAAGTGA
 Primer design