SecReT4
Protein ID: 229589446
T4SS name [ID]Tfc [754]
Gene symbol-
Locus tagPFLU1932
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T4SS(s) in this replicon]
Location [Strand]2108083..2108496 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDC3K5P8
KEGG IDpfs:PFLU1932
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3.6e-44, Aligned region: 10..127
Protein Sequence: 137 a.a.     [Download]
>gi|229589446|ref|YP_002871565.1| hypothetical protein PFLU1932 [Pseudomonas fluorescens SBW25]
MNDTIERLADGTLVFLPERLNRDPAVLRGLTNDEMWVALGTGAVIGLLSGVPLAITTASIAVAPTGMIAG
MTVVLSAGGTLLRRAKRARPETWLYRKLEWVLASRWRLGRGSLIVHSGAWTVRRSRRLRPALSRWQP
 
Nucleotide Sequence: 414 bp     [Download]
>ref|NC_012660.1|:c2108496-2108083 hypothetical protein PFLU1932 [Pseudomonas fluorescens SBW25]
ATGAACGACACTATCGAACGTCTTGCCGACGGCACCTTGGTCTTTCTGCCGGAGCGACTCAACCGTGATC
CCGCCGTGTTGCGCGGCTTGACCAATGATGAGATGTGGGTAGCGCTCGGCACCGGCGCCGTCATTGGTCT
GCTGTCAGGCGTTCCTCTGGCGATCACCACTGCCTCCATTGCAGTGGCGCCGACCGGCATGATCGCGGGC
ATGACGGTGGTGCTATCGGCCGGTGGCACGCTACTGCGGCGGGCCAAACGAGCCCGCCCCGAGACCTGGC
TGTACCGCAAGCTCGAATGGGTACTGGCCAGCCGTTGGCGCCTGGGGCGCGGCAGTCTGATCGTCCACTC
CGGCGCCTGGACGGTTCGCCGTTCGCGTCGACTGCGTCCTGCCCTGTCCCGGTGGCAGCCATGA
 Primer design