SecReT4
Protein ID: 229589449
T4SS name [ID]Tfc [754]
Gene symbol-
Locus tagPFLU1935
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T4SS(s) in this replicon]
Location [Strand]2109129..2109464 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDC3K675
KEGG IDpfs:PFLU1935
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.6e-31, Aligned region: 22..100
Protein Sequence: 111 a.a.     [Download]
>gi|229589449|ref|YP_002871568.1| hypothetical protein PFLU1935 [Pseudomonas fluorescens SBW25]
MPTTAFRCWLLLSLAIVHSSVYAASAQEQDQLSLILQQLDTIEHLATRAEEASTSAPNERYRFDYPRLAQ
DLQRIRQGIQGYLSPSRAQPRDTDELAGDYRVDAPHAEPSP
 
Nucleotide Sequence: 336 bp     [Download]
>ref|NC_012660.1|:c2109464-2109129 hypothetical protein PFLU1935 [Pseudomonas fluorescens SBW25]
ATGCCGACTACCGCCTTTCGCTGCTGGTTACTGCTCTCACTGGCCATCGTCCATAGCAGCGTCTACGCCG
CCTCCGCTCAAGAACAGGATCAGCTCAGTCTGATCCTGCAGCAACTCGACACGATCGAACACCTTGCCAC
GCGTGCCGAGGAAGCCAGCACATCTGCCCCCAACGAACGTTATCGCTTCGACTACCCCCGCCTGGCTCAG
GATCTCCAGCGCATCCGCCAAGGGATACAGGGGTACCTGTCCCCCTCCCGCGCTCAACCCCGCGATACCG
ATGAACTAGCGGGCGATTACCGCGTTGACGCTCCGCACGCGGAGCCCTCGCCATGA
 Primer design