SecReT4
Protein ID: 229589469
T4SS name [ID]Tfc [754]
Gene symbol-
Locus tagPFLU1960
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T4SS(s) in this replicon]
Location [Strand]2134143..2134871 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDC3K771
KEGG IDpfs:PFLU1960
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.4e-67, Aligned region: 45..239
Protein Sequence: 242 a.a.     [Download]
>gi|229589469|ref|YP_002871588.1| hypothetical protein PFLU1960 [Pseudomonas fluorescens SBW25]
MTSAQRPPPQPIQRPGLIVSAISLVLRIIGLLIASLLFSILVEFVGLLLFWGDQGWRHSQAMLSSELGWL
SEHFKSSLILQRPGQTVVQWLDFLHQWLLVNTGFADFAQQARMSSQDNGSWGGINQLYVSIEDFVLAAVY
VSFTFVVRLSILALATPLFLLAMFTGFIDGLMRRDLRKFGAGRESSFVYHRAKRAVMPLLSVPWILYLSL
PFSLNPMAVFLPCAVMLGVAMAITTATFKKYL
 
Nucleotide Sequence: 729 bp     [Download]
>ref|NC_012660.1|:c2134871-2134143 hypothetical protein PFLU1960 [Pseudomonas fluorescens SBW25]
ATGACTTCAGCTCAGCGCCCTCCACCGCAACCCATCCAGCGCCCTGGGCTGATCGTCTCGGCGATTAGCC
TGGTCTTGCGCATTATCGGTTTGCTGATCGCCTCGTTGCTGTTCTCAATCCTGGTCGAGTTCGTCGGTCT
GCTGCTGTTCTGGGGCGATCAAGGCTGGCGACACAGTCAGGCGATGCTGAGCAGTGAACTGGGCTGGCTC
AGTGAGCACTTCAAATCCTCACTGATCCTCCAGAGACCTGGACAGACGGTTGTCCAGTGGCTGGACTTCC
TCCATCAATGGTTGTTGGTCAACACCGGTTTTGCGGATTTCGCCCAGCAGGCGCGGATGTCGAGCCAGGA
CAACGGTTCGTGGGGAGGGATTAATCAGCTGTATGTGAGCATTGAGGATTTTGTCCTGGCGGCGGTGTAT
GTCAGCTTCACCTTCGTGGTGCGTCTGAGCATTCTGGCCCTGGCGACCCCCTTGTTTCTGCTGGCCATGT
TCACCGGTTTCATTGACGGTCTGATGCGCCGCGACCTGCGCAAATTCGGTGCGGGACGAGAAAGCAGCTT
TGTTTATCACCGGGCCAAGCGAGCGGTCATGCCACTGCTGAGCGTACCCTGGATCCTTTATCTGTCGCTG
CCCTTTTCGCTCAATCCCATGGCGGTATTTCTGCCGTGCGCCGTGATGCTCGGGGTGGCCATGGCCATCA
CGACGGCGACGTTCAAAAAATATCTCTGA
 Primer design