SecReT4
Protein ID: 229589470
T4SS name [ID]Tfc [754]
Gene symbol-
Locus tagPFLU1961
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T4SS(s) in this replicon]
Location [Strand]2134909..2137068 [-]
Productputative traG-like protein
Component typeTfc6
UniProt IDC3K772
KEGG IDpfs:PFLU1961
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.4e-16, Aligned region: 503..633
AAA_10 [PF12846], Evalue: 1.8e-08, Aligned region: 189..580
TrwB_AAD_bind [PF10412], Evalue: 3.7e-08, Aligned region: 504..640
Protein Sequence: 719 a.a.     [Download]
>gi|229589470|ref|YP_002871589.1| putative traG-like protein [Pseudomonas fluorescens SBW25]
MAEHAMESKLRPAVELYTVAICVAAGVLCVYSPWAVALSPEIGVVAALAYALFGLIRLQQAWEVLRYRRN
IRRLPRYELTSRQIPVSRKRLFMGRGFRWTRLHTQRLAEAQDPAVAHYVDQPTCYRLARELERRLEHAPF
PLSTLARVTAWDNAFNRVRPLPPVGGSSLLHGVEPDETEVSLPLGERVGHTLVLGTTRVGKTRLAEVYIT
QDIHRVEHEVVIVFDPKGDADLLKRMYVEAKRAGREKEFYVFHLGWPEISARYNAVGRFGRISEVASRIA
GQLSGEGNSAAFREFAWRFVNIIARALIELGRRPDYLQIQRHVVNIDALFIEYAQQFFAKTDPKAWEVIV
QLEGKLTEKNIPRHMVGREKRVVAIEQYLAVKRVFDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKLTTG
KTAQLLAPNYTDLEDPRPIFDWMQIIRKRGIVYVGLDALTDAEVAAAVGNSMFADLVSVAGHIYKHGIDH
GLPSAGSSADKLPINLHADEFNELMGDEFIPLINKGGGAGIQVTAYTQTLSDIEARIGNRAKAGQVIGNF
NTLQMLRVRETATAELLTQQLPKINVLTKTLVSGATDTSDPEANTDFTSSSQDRVSSTSVPLIEPAHIVS
LPKGQMFSFQVGGQLWKVRMPLPKPSPDDAMPKNLQELTQRMRASYNEQAGHWWSASGGGPTLDFDPDRV
TPARPSVAVDTSGPTQEVP
 
Nucleotide Sequence: 2160 bp     [Download]
>ref|NC_012660.1|:c2137068-2134909 putative traG-like protein [Pseudomonas fluorescens SBW25]
ATGGCCGAGCATGCGATGGAGTCCAAGCTCCGGCCGGCAGTGGAGCTGTACACGGTAGCGATCTGCGTCG
CTGCCGGAGTGTTGTGCGTGTACTCGCCCTGGGCTGTGGCCCTGTCACCCGAGATCGGTGTGGTTGCAGC
GCTGGCCTATGCCCTGTTCGGCCTGATCCGGCTGCAACAAGCCTGGGAGGTGCTGCGCTATCGGCGCAAT
ATCCGCCGGCTGCCTCGCTACGAACTGACCAGCCGACAGATTCCGGTCAGTCGTAAGCGTTTGTTCATGG
GCCGCGGCTTTCGCTGGACACGCCTGCACACCCAGCGCTTGGCGGAGGCCCAGGATCCGGCGGTTGCTCA
TTATGTCGACCAACCGACCTGCTATCGTCTGGCCCGTGAACTCGAACGGCGCCTGGAACATGCGCCATTT
CCGCTCTCGACCCTGGCGCGTGTCACGGCCTGGGACAACGCCTTCAATCGGGTGCGCCCTTTGCCCCCGG
TAGGCGGCTCGTCGCTGCTACATGGGGTCGAGCCCGACGAAACGGAAGTCAGTCTGCCGCTGGGTGAACG
GGTCGGACACACCCTGGTGCTGGGCACTACCCGCGTCGGCAAGACGCGGCTGGCTGAGGTGTACATCACC
CAGGACATACACCGAGTCGAACACGAGGTAGTGATTGTCTTCGACCCGAAAGGCGATGCCGACCTGCTCA
AGCGCATGTACGTCGAAGCCAAACGCGCCGGTCGGGAGAAGGAGTTTTATGTGTTTCATCTAGGCTGGCC
GGAGATCTCCGCGCGCTACAACGCCGTGGGACGTTTCGGGCGCATCTCGGAAGTGGCGTCGCGCATTGCT
GGGCAGCTCAGTGGTGAAGGCAACTCCGCAGCCTTTCGTGAGTTCGCCTGGCGTTTCGTCAACATCATCG
CCCGCGCACTGATCGAGCTGGGCCGACGCCCGGACTACCTGCAGATCCAGCGACATGTGGTCAACATCGA
CGCACTGTTCATCGAATACGCCCAGCAGTTTTTCGCCAAGACCGATCCGAAGGCCTGGGAAGTGATCGTC
CAGCTTGAAGGTAAGCTCACCGAGAAGAACATTCCCCGGCATATGGTCGGCCGCGAAAAGCGCGTGGTGG
CCATCGAACAATACCTGGCAGTGAAACGAGTCTTTGATCCGGTGCTGGACGGGCTGCGATCGGCAGTGCG
CTATGACCGCACCTACTTCGACAAAATCGTCGCCTCGCTGCTGCCGCTGCTGGAAAAACTCACCACCGGC
AAGACCGCGCAGTTGCTGGCCCCCAATTACACTGATCTGGAGGATCCACGGCCAATCTTCGACTGGATGC
AGATCATCCGCAAACGCGGCATCGTCTATGTCGGTCTGGATGCGCTGACCGACGCGGAAGTGGCTGCCGC
CGTAGGCAACTCCATGTTCGCCGATCTGGTCTCGGTGGCTGGGCACATCTACAAGCATGGCATCGACCAT
GGCTTGCCTTCCGCAGGCAGCAGCGCCGACAAGCTACCGATTAACCTGCATGCCGATGAGTTCAACGAGT
TGATGGGTGATGAATTCATTCCGCTGATCAACAAGGGCGGCGGAGCGGGCATCCAGGTGACGGCGTACAC
CCAGACCCTCAGCGATATCGAGGCGCGCATCGGCAACCGCGCGAAAGCCGGCCAGGTCATCGGTAATTTC
AACACCCTGCAGATGCTCCGAGTGCGCGAAACCGCCACTGCGGAGCTGCTCACCCAACAGTTGCCTAAGA
TCAACGTGCTGACCAAAACCTTGGTCTCGGGTGCCACAGACACCTCCGACCCCGAGGCCAACACGGACTT
CACCTCGTCCTCCCAAGACCGGGTCAGCAGCACCAGCGTGCCCCTGATCGAGCCGGCTCACATCGTCAGT
TTGCCCAAAGGGCAGATGTTCTCCTTCCAGGTGGGAGGGCAGCTCTGGAAAGTCCGCATGCCACTGCCCA
AGCCTTCGCCGGACGATGCCATGCCCAAGAATCTGCAGGAGCTGACTCAGCGGATGCGCGCCAGCTACAA
CGAGCAGGCGGGACACTGGTGGAGTGCCAGCGGGGGCGGTCCCACGCTCGACTTCGATCCGGACCGAGTC
ACGCCAGCCCGCCCCTCTGTAGCGGTGGACACGAGTGGGCCTACTCAGGAGGTCCCATGA
 Primer design