SecReT4
Protein ID: 229589472
T4SS name [ID]Tfc [754]
Gene symbol-
Locus tagPFLU1963
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T4SS(s) in this replicon]
Location [Strand]2137581..2138129 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDC3K774
KEGG IDpfs:PFLU1963
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 182 a.a.     [Download]
>gi|229589472|ref|YP_002871591.1| hypothetical protein PFLU1963 [Pseudomonas fluorescens SBW25]
MATPRLSGIALLLTMLAVQADELPPPAYQLAAHDADIPSTVLFAIALQESGIRVRGRLLPWPWTLNIAGT
PYRFATRQAACHALLQALARQNAKRVDAGLGQTNLGYHGQRFSSPCEALDPYRNLAVTAALLQEHHAATG
DWVLAAGRYHRPAGGIPAARYRAEFTRQFERLLVSFKQGTPP
 
Nucleotide Sequence: 549 bp     [Download]
>ref|NC_012660.1|:c2138129-2137581 hypothetical protein PFLU1963 [Pseudomonas fluorescens SBW25]
ATGGCAACGCCTCGATTGAGTGGTATTGCGCTCCTGCTGACGATGCTTGCCGTCCAGGCGGATGAACTCC
CGCCGCCTGCCTACCAATTGGCGGCGCATGACGCCGACATCCCTTCTACGGTGCTGTTTGCGATTGCCCT
GCAGGAGAGTGGCATTCGCGTCCGAGGTCGGCTGCTGCCCTGGCCGTGGACGCTGAATATTGCCGGTACC
CCTTACCGCTTCGCCACTCGCCAAGCCGCCTGTCACGCCTTGCTTCAGGCGCTAGCCCGACAAAACGCCA
AGCGGGTCGATGCCGGACTCGGGCAAACCAACCTGGGTTATCACGGGCAACGTTTTTCCAGCCCTTGTGA
AGCCCTCGACCCCTACCGAAATCTCGCGGTGACCGCCGCGCTGTTGCAGGAGCATCACGCCGCCACCGGT
GATTGGGTATTGGCTGCCGGGCGCTATCACCGCCCAGCGGGAGGTATACCTGCCGCGCGTTACCGCGCCG
AATTTACCCGGCAATTCGAACGGTTGCTGGTTTCCTTCAAACAGGGCACACCACCATGA
 Primer design