SecReT4
Protein ID: 229589474
T4SS name [ID]Tfc [754]
Gene symbol-
Locus tagPFLU1965
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T4SS(s) in this replicon]
Location [Strand]2138840..2139511 [-]
Producthypothetical protein
Component typeTfc2
UniProt IDC3K776
KEGG IDpfs:PFLU1965
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 223 a.a.     [Download]
>gi|229589474|ref|YP_002871593.1| hypothetical protein PFLU1965 [Pseudomonas fluorescens SBW25]
MKASTFQTLIIGLLCLAVAGLSGGLYNQYQHLAELQSTNTQSQQTLDTLQRDSNALKDTQEKLQYALKDL
KQMVDTGEQQANTLDPMLDQWAQEIQELRDGLTARATAADMTALRARLEQVEQQLLELKTQPSTPPSTSS
TAKPKQTAHPKPISLSPPFSVLSVESRGGERFLAVAPHDSRSLRDVRLLHSGEQQGAWRLKILEPNSAIF
AVVAQPDQTVHLP
 
Nucleotide Sequence: 672 bp     [Download]
>ref|NC_012660.1|:c2139511-2138840 hypothetical protein PFLU1965 [Pseudomonas fluorescens SBW25]
ATGAAAGCCTCGACGTTTCAAACCCTCATCATTGGGCTGCTTTGCCTCGCGGTCGCCGGTCTGAGCGGTG
GTTTGTATAACCAATATCAACACCTGGCCGAGCTACAGAGCACGAACACCCAATCCCAACAAACCCTGGA
CACCCTGCAACGTGATTCAAACGCCCTCAAGGATACACAGGAAAAACTGCAGTACGCGCTGAAAGACCTG
AAGCAGATGGTCGATACCGGTGAGCAACAGGCCAATACCCTCGATCCCATGCTGGATCAATGGGCGCAAG
AAATACAGGAACTGCGCGACGGTCTGACAGCCCGCGCCACCGCAGCGGACATGACCGCGCTACGCGCACG
CCTTGAGCAAGTCGAGCAACAGCTCCTGGAGCTCAAGACCCAGCCATCAACTCCACCATCGACGTCTTCC
ACGGCCAAGCCGAAACAGACCGCTCACCCCAAACCCATCTCGCTCTCGCCGCCGTTTTCAGTGTTGAGTG
TCGAGTCCCGCGGGGGTGAGCGTTTTCTGGCGGTCGCACCTCATGACAGCCGCTCGCTCAGGGATGTTCG
GCTGCTGCATAGCGGCGAGCAGCAAGGGGCTTGGCGCCTGAAAATACTGGAGCCGAACTCAGCCATCTTC
GCAGTGGTCGCTCAGCCAGACCAGACCGTGCACCTCCCTTGA
 Primer design