SecReT4
Protein ID: 229608745
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003667
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]2964666..2968235 [-]
ProductIncF plasmid conjugative transfer protein TraG
Component typeTraG_F
UniProt IDC3NU06
KEGG IDvcj:VCD_003667
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 9.3e-103, Aligned region: 3..462
Protein Sequence: 1189 a.a.     [Download]
>gi|229608745|ref|YP_002879393.1| IncF plasmid conjugative transfer protein TraG [Vibrio cholerae MJ-1236]
MWEIYSIGDSAFLEQVLNAVAMITGTGDFTSMVRIGLLIGVLMVSVQALMQGGRGINFQHVLVSWLVFAT
MFGPSTRVSIEDAYTGQVRVVDNVPIGVAAAGSTISTVGFQITRLFETAFSTPAMTEYGFASSLQSLIKV
RKQVMDRSGLGDANRVGGSDIEQSWFNYIKECTLIGIDIGQKNLDQVLSDPNPMTAIRFDSRIYGTRIML
SGSSSDLDCTDAYSQLKLMTESTFIPRLKQVLSASLGTSSATDTDDVIRNALNNLGLASVNTQEYMTASV
LLPIYEQSVTGKYMDDQAFTAAVMVNQAIEQRNTQWAAEQTLFQSIVRPMMTFFEGFIYAITPLMAFVIA
LGQIGMRMAGKYLLILLWIQLWMPVMAIINLYIHLTVAGKMSSLDAFAGTEVPSFAGMMQMDSVLQTWIA
TGGMLASSVPAISLMLVYGSAITATHLAGRLQNGDAIDEKMASPDVAKNAPVMQSQSMFQNSALTGSAMT
GASNLLSSFSVGNAVGSMVGSAKESMTQATQAFSRQVGNTMSRTFGEKLSYDNLSSVGRQIGSSNSASSA
VVNQVTDDLQTRYGFGDDKKDAVRGLVSGVLSGGLRVGGDGTITNTGDKEVADKGFLGRLLSTGGNDSPQ
GNLPGVDKPESSRVPKISRLRAGLDLGGNFSGQVESSEGSSRSTTANTLTGEMQSLASSDSRRAEYRDAM
VKDLSDSRRSGVEMSLSNQDYQSLQSSAQDVITASNRFSELDQASYSLSGQRNTDGATLTRLAADNPEVM
DYLGRYMNQHVEAGNRLRENLPMYQRLLPDDNQAYVAAAMESLTYSNSSTPAERDNDYQAAMTVMAMATG
ADLRSIQPRSNEGLSSTAPTFGGTQSQVESGVLGGYEDAATVQTQFNAAQSAYQTNLSGVDGQLNAHQQQ
AQQAVVSDTSTYQSGLNREAGSQWRSRIMADDSGVSGAEMFFNSASAIGDFSGKHTDAALHTLNHFGEDY
ESYKEQALEDPSSRGFLHNATVASKSTWDGLKAAVDAGTSLENPLTAFNDAYSGSSSQYASEVNWGTKSE
AMLAGAFGAAVNNRYGEFLEQYADDFKQEAYSEGQRMGLTPIQSQVFAQAFNEGLAGRVFNSEDSSSWSP
EMLGLREQMLNEYRQKDESGAYIPDSVSEEDKAFVDKQIAVISNASLAGDYAQNNLIDIRAYNQASGRN
 
Nucleotide Sequence: 3570 bp     [Download]
>ref|NC_012668.1|:c2968235-2964666 IncF plasmid conjugative transfer protein TraG [Vibrio cholerae MJ-1236]
ATGTGGGAGATCTATTCCATCGGGGATTCGGCATTTTTAGAGCAGGTCTTGAACGCTGTCGCGATGATCA
CTGGTACAGGCGATTTTACTTCAATGGTTCGCATTGGCTTGCTCATTGGGGTATTGATGGTCTCTGTTCA
GGCCTTAATGCAAGGTGGTCGTGGGATTAACTTTCAACATGTTTTAGTCTCATGGCTAGTCTTTGCAACC
ATGTTTGGGCCCAGTACCCGAGTGAGCATTGAGGATGCGTACACGGGACAAGTTCGAGTGGTTGATAATG
TGCCCATCGGTGTTGCTGCCGCAGGCAGTACGATTTCGACTGTTGGCTTTCAAATCACGCGATTGTTTGA
AACCGCCTTCTCAACTCCCGCCATGACGGAATACGGCTTTGCATCCAGTTTACAGTCACTGATTAAAGTG
AGAAAACAGGTGATGGATCGCTCTGGGTTGGGTGATGCAAATCGTGTCGGCGGCTCGGACATCGAGCAAT
CGTGGTTTAACTACATCAAAGAGTGCACCTTGATTGGTATCGACATTGGCCAAAAGAACCTCGATCAGGT
GCTGAGTGATCCTAATCCGATGACTGCGATTAGGTTTGATTCGCGTATTTATGGCACACGCATCATGCTT
AGTGGTAGCAGTAGCGATCTGGACTGCACCGATGCCTACAGCCAACTGAAACTCATGACAGAATCAACCT
TCATACCAAGGCTTAAACAGGTTCTGTCGGCCTCATTGGGGACTTCGTCAGCAACGGACACTGATGACGT
GATCCGAAATGCACTGAATAACCTTGGTTTGGCTTCGGTTAACACCCAAGAGTACATGACCGCGTCGGTG
CTTTTGCCTATTTATGAGCAAAGCGTGACGGGCAAATATATGGATGACCAAGCTTTCACCGCAGCCGTGA
TGGTTAACCAAGCGATTGAGCAGCGCAATACGCAATGGGCTGCGGAGCAGACCCTGTTCCAAAGTATCGT
TCGTCCGATGATGACGTTTTTTGAGGGTTTCATTTACGCCATCACCCCATTGATGGCCTTTGTGATTGCC
CTTGGCCAAATCGGGATGCGAATGGCCGGGAAGTACTTGTTAATCCTGCTTTGGATTCAACTTTGGATGC
CTGTCATGGCCATCATTAACCTGTATATTCATTTAACCGTTGCAGGGAAAATGTCGTCGCTTGATGCCTT
TGCAGGTACAGAAGTGCCATCTTTTGCTGGGATGATGCAGATGGATTCAGTGCTGCAAACCTGGATAGCT
ACTGGCGGCATGTTGGCGTCGAGTGTTCCGGCAATTTCGCTCATGCTCGTGTATGGCTCAGCAATAACCG
CTACCCACTTGGCTGGACGTCTTCAAAACGGTGATGCCATTGATGAAAAGATGGCAAGTCCAGATGTCGC
GAAAAATGCCCCGGTAATGCAATCACAGTCAATGTTCCAAAATTCAGCCCTCACAGGTTCTGCAATGACC
GGTGCGTCAAACTTACTAAGCAGTTTCTCTGTCGGAAATGCGGTGGGTTCAATGGTCGGTTCTGCAAAAG
AATCCATGACTCAGGCAACTCAAGCCTTTAGCCGTCAAGTTGGCAATACCATGAGTCGAACTTTTGGTGA
AAAGCTAAGTTACGACAACCTTTCTTCGGTTGGACGTCAGATCGGTTCTTCTAATTCCGCATCTAGCGCC
GTTGTTAATCAGGTTACTGATGACCTGCAAACACGGTATGGTTTCGGAGACGATAAAAAAGACGCTGTAC
GTGGCTTGGTATCGGGCGTGTTATCGGGAGGCCTTAGGGTCGGTGGAGATGGAACCATTACAAATACCGG
TGATAAAGAAGTAGCAGATAAAGGGTTCTTGGGAAGATTACTTAGTACAGGAGGGAATGACTCCCCACAA
GGCAACCTACCAGGAGTGGATAAGCCTGAATCATCAAGAGTGCCAAAAATATCACGGTTACGAGCAGGCT
TGGATTTAGGTGGTAACTTTAGTGGCCAAGTTGAGTCATCAGAGGGCAGTTCTCGGTCAACGACCGCAAA
TACGCTCACTGGGGAGATGCAAAGCTTGGCATCAAGTGATTCACGACGTGCTGAGTATCGCGATGCAATG
GTTAAGGACCTTTCAGATTCAAGACGCTCTGGCGTTGAGATGTCGTTGTCTAATCAAGACTATCAGTCAC
TTCAGAGTTCAGCACAAGACGTTATCACGGCATCAAACCGCTTTAGTGAGCTTGATCAGGCCAGCTACAG
TCTATCAGGACAAAGGAACACGGATGGTGCGACGTTAACTCGATTAGCAGCGGATAATCCTGAAGTCATG
GATTATTTAGGTCGCTATATGAACCAGCATGTTGAAGCAGGTAACCGATTACGTGAAAACCTTCCAATGT
ATCAGCGCTTGCTACCTGATGATAATCAGGCGTATGTGGCCGCAGCTATGGAGTCTTTAACCTATAGCAA
CTCCTCGACGCCCGCTGAACGAGACAATGACTATCAAGCAGCAATGACTGTTATGGCCATGGCTACCGGA
GCCGATTTACGATCTATTCAGCCACGCTCTAATGAAGGCTTGTCATCAACTGCACCTACTTTTGGTGGCA
CTCAAAGCCAAGTGGAATCGGGTGTATTGGGCGGCTACGAGGATGCTGCAACTGTTCAAACTCAGTTCAA
CGCAGCTCAATCAGCTTACCAAACTAATTTGTCTGGTGTTGATGGACAACTAAATGCGCATCAACAACAA
GCCCAACAGGCCGTAGTTTCTGACACAAGTACCTATCAATCTGGACTAAACCGTGAAGCTGGCTCTCAGT
GGCGATCTCGCATTATGGCTGATGATAGCGGAGTTTCTGGTGCTGAAATGTTCTTCAACAGCGCCAGTGC
TATTGGTGACTTCAGTGGCAAGCATACTGATGCAGCACTGCATACCTTGAATCACTTTGGCGAAGACTAT
GAGAGTTACAAGGAGCAAGCACTTGAAGACCCTAGCTCACGAGGTTTCTTGCACAATGCAACGGTGGCCA
GTAAATCAACCTGGGATGGCTTAAAAGCAGCCGTTGACGCCGGAACCTCTTTGGAAAACCCATTGACGGC
GTTTAATGATGCATACAGTGGATCGAGTTCGCAGTATGCCTCCGAAGTAAACTGGGGCACTAAGTCTGAA
GCCATGTTGGCTGGGGCATTCGGTGCGGCAGTTAACAATCGATATGGTGAGTTCTTAGAACAGTATGCCG
ATGATTTTAAACAGGAAGCATACAGCGAAGGGCAGAGAATGGGATTGACCCCGATTCAAAGTCAAGTGTT
CGCTCAAGCTTTCAATGAAGGTTTGGCGGGGCGCGTTTTCAACTCTGAAGACTCATCGAGTTGGTCGCCT
GAAATGCTTGGTCTAAGGGAGCAAATGCTAAATGAGTATCGTCAAAAAGATGAGAGCGGTGCTTACATCC
CCGACAGTGTGTCCGAAGAAGATAAAGCATTTGTGGATAAGCAGATTGCAGTGATCTCAAATGCATCCCT
TGCTGGAGATTATGCTCAGAACAACTTGATCGATATTAGGGCCTATAACCAGGCTTCAGGAAGGAACTAA
 Primer design