SecReT4
Protein ID: 229608746
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003668
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]2968239..2969627 [-]
ProductIncF plasmid conjugative transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDC3NU07
KEGG IDvcj:VCD_003668
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 7.3e-103, Aligned region: 28..389
Myb_Cef [PF11831], Evalue: 7.6e-06, Aligned region: 367..456
Protein Sequence: 462 a.a.     [Download]
>gi|229608746|ref|YP_002879394.1| IncF plasmid conjugative transfer pilus assembly protein TraH [Vibrio cholerae MJ-1236]
MKKVFQVSLIACAIGFSSMSQASLQQEMNQLFGSMTNSTAPGVFESQRRGVISGGSVVVRNRIMNENLVS
MVPPSFQAGCGGIDMFAGSLSFVNADQFVQLLRSVAANAKGYAFQLALSAMCEKCSQHMETLQKKIQQLN
EYFGNSCQMAQGVVNDTLAAFGKKGQTEASMLSSLKGAGDVFTSWSESNGKNPYENASSVAASDVNKTIK
GNLVWRALKRHSASSWFASGDDRFLEAVMSVTGSIIVGDLANAADGQGKAPKLTRLNGNKVTIEHLIHGG
NVAMYRCDTVTQDGCLNPTITNVTLTGLSTQVENLLLGTGSSHGIIFKFARNTGAASTTEKAFMTSAPAS
IGGMIRTLSALNEGAARSFASRAAPFIAVEMARALVEDMLNAARSTSGVEDHAYAKLLTEDLERARRQIN
EEYAALQRRYGSEQELLAHFNQVIQTIRKQRYYTVKSTALGE
 
Nucleotide Sequence: 1389 bp     [Download]
>ref|NC_012668.1|:c2969627-2968239 IncF plasmid conjugative transfer pilus assembly protein TraH [Vibrio cholerae MJ-1236]
ATGAAAAAAGTATTCCAAGTATCGCTAATCGCCTGTGCGATTGGTTTTTCGTCTATGAGCCAAGCAAGCT
TGCAACAGGAGATGAATCAGTTGTTTGGTTCAATGACCAACAGCACTGCGCCTGGTGTATTCGAGAGTCA
GCGGCGTGGCGTTATATCTGGCGGAAGTGTTGTTGTTCGTAACAGGATCATGAACGAGAACCTCGTCTCT
ATGGTGCCTCCGTCATTCCAAGCCGGTTGTGGCGGCATTGATATGTTCGCTGGAAGTTTGTCATTTGTTA
ATGCAGATCAGTTCGTTCAATTGCTTCGCTCTGTAGCGGCAAATGCCAAGGGGTACGCATTCCAATTGGC
GCTCAGTGCTATGTGTGAGAAATGTTCCCAGCACATGGAGACTCTGCAAAAGAAAATCCAGCAGTTGAAC
GAGTATTTTGGCAATTCCTGTCAAATGGCTCAGGGAGTCGTGAACGATACCTTGGCTGCTTTTGGTAAAA
AGGGGCAAACAGAAGCCAGCATGTTGAGCTCACTTAAAGGGGCTGGAGACGTTTTTACCAGTTGGAGTGA
GTCCAATGGTAAGAACCCATACGAGAACGCTTCGAGTGTCGCGGCATCTGATGTGAACAAAACGATTAAA
GGCAACTTGGTTTGGCGAGCACTGAAACGTCACTCGGCATCAAGCTGGTTTGCATCTGGGGATGACCGTT
TTCTTGAAGCGGTTATGTCGGTGACTGGTTCGATCATCGTTGGTGATTTAGCCAATGCCGCTGATGGTCA
AGGAAAAGCCCCGAAACTGACCAGACTGAATGGCAATAAAGTGACTATTGAGCATCTAATTCATGGTGGT
AACGTCGCTATGTACCGATGTGACACAGTGACACAAGACGGCTGCCTTAATCCAACAATCACTAACGTGA
CCCTTACCGGGTTATCAACTCAGGTAGAAAATTTACTTCTTGGTACAGGTTCTAGTCACGGCATTATTTT
TAAGTTTGCTCGAAATACAGGGGCAGCTAGCACCACCGAAAAGGCTTTTATGACCTCGGCTCCTGCAAGC
ATTGGCGGCATGATTCGAACTCTTTCTGCATTAAATGAAGGGGCTGCTAGGTCGTTTGCTTCTAGAGCTG
CACCATTTATTGCTGTTGAGATGGCCCGAGCATTGGTTGAAGACATGCTCAACGCAGCTAGAAGCACATC
GGGTGTGGAAGATCATGCCTATGCGAAGTTGTTAACGGAAGATCTTGAACGTGCACGTCGCCAAATCAAT
GAGGAGTACGCCGCGTTGCAGCGAAGATACGGCTCAGAGCAAGAATTGCTGGCGCACTTTAATCAGGTGA
TTCAGACCATTCGCAAGCAGCGTTATTACACCGTTAAATCTACGGCACTGGGGGAATAG
 Primer design