SecReT4
Protein ID: 229608747
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003669
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]2969630..2970574 [-]
ProductIncF plasmid conjugative transfer pilus assembly protein TraF
Component typeTraF_F
UniProt IDC3NU08
KEGG IDvcj:VCD_003669
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.5e-73, Aligned region: 41..260
Protein Sequence: 314 a.a.     [Download]
>gi|229608747|ref|YP_002879395.1| IncF plasmid conjugative transfer pilus assembly protein TraF [Vibrio cholerae MJ-1236]
MRTPLFPWFILWVTIPIIIFFLFILPAHASDGQFYQRGQEGWFWYQVIPEPAEDEEPIKPESGAAESSQS
GLKPFSAAWFREHMQSFMDKAIDEPTTENVRAYLYLQRVMMDKGSLFADVSQQVVMGDPVLDEISRRPLA
TYAANRMDREAGAQRDIALGEVAKRAGLFFFYRSDCPYCHAQAPIIESMALNYGFEVFAIAVDGLPLPGG
EFPNYKVDSGQAQSLSVTTVPAVFLVDPPNVITPIGQGAMSLDELNNRIILAAHQAGWIDDQTYYATRPV
QPGVSLAMSAQELNEKILQDPEFLVRYLRAQGGL
 
Nucleotide Sequence: 945 bp     [Download]
>ref|NC_012668.1|:c2970574-2969630 IncF plasmid conjugative transfer pilus assembly protein TraF [Vibrio cholerae MJ-1236]
ATGAGAACCCCCTTGTTCCCTTGGTTCATCCTATGGGTGACCATCCCAATCATTATTTTCTTTCTATTCA
TCCTGCCCGCCCATGCTAGTGATGGGCAATTCTATCAGCGTGGTCAGGAAGGCTGGTTTTGGTATCAGGT
CATTCCTGAGCCAGCGGAGGATGAAGAGCCTATAAAGCCGGAATCAGGTGCGGCAGAGTCGAGTCAGAGC
GGGCTAAAGCCTTTCAGTGCTGCTTGGTTTCGTGAGCACATGCAGTCGTTCATGGATAAGGCAATTGATG
AGCCGACCACTGAGAACGTCCGAGCCTATCTGTATCTTCAGCGCGTTATGATGGATAAGGGCTCACTATT
TGCTGATGTTAGTCAGCAGGTTGTCATGGGTGATCCTGTTTTGGATGAAATCAGTCGCAGACCCTTGGCT
ACCTATGCTGCCAATCGGATGGATCGAGAAGCTGGCGCTCAACGAGATATTGCTTTAGGTGAAGTAGCAA
AACGGGCTGGCTTGTTCTTCTTCTATCGTTCGGATTGCCCTTACTGCCATGCTCAAGCGCCTATCATCGA
ATCCATGGCTTTGAACTATGGTTTCGAGGTGTTTGCTATTGCAGTCGATGGCTTGCCTTTACCTGGTGGA
GAGTTTCCTAATTACAAAGTCGATTCAGGACAAGCTCAATCCTTGTCCGTTACGACTGTCCCTGCCGTGT
TCTTAGTTGATCCGCCTAATGTCATCACTCCGATTGGCCAAGGCGCAATGAGCCTTGATGAGCTCAATAA
TCGAATCATTCTTGCAGCCCATCAAGCCGGTTGGATTGACGATCAAACTTACTATGCCACCAGACCTGTT
CAACCCGGCGTGTCACTCGCGATGTCAGCCCAAGAGCTTAACGAAAAGATATTACAGGACCCTGAGTTCC
TTGTTCGCTATCTGCGTGCACAAGGAGGGTTATAA
 Primer design