SecReT4
Protein ID: 229608769
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003691
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]2988974..2992615 [-]
ProductIncF plasmid conjugative transfer protein TraN
Component typeTraN_F
UniProt IDC3NU30
KEGG IDvcj:VCD_003691
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 5.2e-87, Aligned region: 356..445
TraN [PF06986], Evalue: 5.2e-87, Aligned region: 723..988
TraN [PF06986], Evalue: 5.2e-87, Aligned region: 1055..1131
Protein Sequence: 1213 a.a.     [Download]
>gi|229608769|ref|YP_002879417.1| IncF plasmid conjugative transfer protein TraN [Vibrio cholerae MJ-1236]
MACLPLHGVAADVQRQSGLSGQQEGKQLLQNWTMPALNGNTLLVPSGSGNESINLQELFPGMDQGSLDVL
TGVYGSDASMNQLGTQRQESMASESGATGEAFRSLQQIKDRSRPDMVNDPLWALTDAVQTDPNLLTQSFP
GCESQGEGSPNYQQCDRLNTAVNSCTITHDYTAGIIEHVSGPMNLRSCGEGCLEVWIGRIGDNYWSGRCK
VFEQAITLKVVNPDAITSAVLEYAKWDDYMQVWLGDQKVWSGPNNNFPPETAGRCELSTSWERNPNTDLT
AKLKAVEPGLEVPVKIRVSVTGSGEGYARIKVRFDPTKVVMNDSWSPQSCIEQAADIPTKFSDYSIQCTD
QPSSTNGCTVVNGVSVCESYFAPSPVAGISPLCRRVQVSVDDESYKGIENQACQVLEANPSCGFMSSECA
ETNDKGECIRFTDTYDCGLQTSDPKCVVSNLMPSSFEACEPTQTITPFTETKHVPDYQVCEKISTLTECQ
LERRVSAETHQQSWSIERGCFSSETLSFVPQHSSTMQTGNAILRIFDNQNTEIKITESPSKANGWKTTLS
LTGNKETVTETKPSIKYPEMTCPKGTLVGSLCKVANGSIISWHEPQEVTRSRCESGWNKVDFDTCSREVQ
KCLAPAKLSASLTFSGKYLEQDVVHQSSDPGIDQCLMQTDQFTAVQWQCLDTGTKRIDGLTVGSGELANL
GSLYPAVVSSPVHLTSRGSSDGLGLSCWRARATYNASTAHPEFNMGSSDSWVDANGNTQTIVNNGQNTTT
NTCAALEQNLACQYVRTECTEGGAGHEGFCYIQSLVYDCGQSVEVQNARMETQYNCEGPVRCMGTDCLEP
ESIKQANFAEAAAMLNAAQFMTNDMSCTGADGQDNVECTVFKGNAGQCKKAVGGIVDCCEKPSGVSLSDY
ITMIVAVNKLDTAVMAMNPSSAIYGSWNTLREPITSTWSAVKEPFVSAWDSLMGAGPSTAAGAGAEQAAT
GFMQVLTNKTAEWVGSTFGSGAQSALFSNVGGAVGADGVVSGGNFALGGAAGAVLSTVMTAYMIYSVTMI
LIQLIWKCEQSEFEMNAKRVLKSCHYVGSYCKSKFLGACVEKRQSYCCFTSPLSRIIQEQVRPQLGLGWG
SAKSPNCEGLTASQLNQVDWSQVNLDEWIGILSITGNLPEVPSLDLERLTGSGSTLNVDGNRQSAADRAI
ERLNGMDAQKLRQEATEEISGNN
 
Nucleotide Sequence: 3642 bp     [Download]
>ref|NC_012668.1|:c2992615-2988974 IncF plasmid conjugative transfer protein TraN [Vibrio cholerae MJ-1236]
ATGGCTTGCTTGCCCTTACATGGTGTGGCCGCTGATGTGCAGCGCCAATCCGGCTTAAGCGGACAACAAG
AAGGTAAGCAATTACTGCAAAACTGGACGATGCCCGCACTTAACGGCAATACATTGTTGGTGCCGAGTGG
CAGTGGTAATGAGTCCATTAACTTGCAAGAGCTATTTCCTGGTATGGATCAGGGCTCATTAGATGTCTTA
ACGGGCGTTTATGGCTCTGATGCCAGCATGAATCAATTGGGGACGCAGCGCCAAGAGAGCATGGCATCCG
AAAGTGGCGCTACGGGTGAGGCGTTTCGCTCGCTACAGCAAATCAAAGACAGGTCTCGGCCAGATATGGT
CAATGATCCGCTTTGGGCATTAACTGATGCGGTTCAAACTGACCCCAATCTATTAACCCAAAGCTTCCCC
GGCTGTGAGTCTCAAGGTGAAGGCAGCCCAAATTACCAGCAATGTGACAGGCTCAATACAGCGGTTAACA
GCTGCACTATTACTCACGATTACACGGCAGGCATCATTGAGCATGTTTCAGGGCCGATGAACCTTCGCTC
TTGTGGTGAGGGGTGTCTTGAAGTTTGGATTGGACGAATTGGCGACAACTACTGGAGTGGCCGTTGTAAA
GTGTTTGAACAGGCCATCACACTCAAAGTCGTGAACCCCGATGCGATTACCTCAGCCGTTCTTGAATACG
CCAAATGGGATGACTACATGCAAGTGTGGCTTGGTGATCAGAAAGTCTGGTCTGGGCCGAACAATAACTT
TCCACCAGAAACGGCAGGTCGTTGCGAGCTCAGTACCAGTTGGGAGCGCAATCCAAATACCGATCTCACT
GCCAAGCTAAAAGCGGTAGAACCAGGTTTAGAAGTGCCGGTAAAAATTCGCGTATCGGTTACGGGTAGTG
GTGAGGGCTATGCACGCATAAAGGTGCGCTTTGATCCAACCAAGGTAGTGATGAATGATAGTTGGTCGCC
ACAATCCTGTATCGAACAAGCAGCGGATATCCCGACGAAGTTTTCAGACTACAGCATTCAATGCACGGAT
CAGCCTTCTTCAACCAACGGATGTACGGTGGTCAATGGTGTTTCAGTTTGTGAATCCTACTTTGCCCCTA
GCCCTGTGGCTGGCATATCGCCTTTGTGTCGGCGTGTACAAGTCAGTGTGGATGATGAAAGCTATAAGGG
GATTGAAAATCAGGCCTGCCAAGTGCTTGAAGCGAATCCTTCCTGTGGATTCATGTCGTCAGAATGTGCC
GAGACCAATGATAAAGGTGAATGCATTCGTTTTACCGATACCTATGACTGTGGATTGCAAACCAGCGATC
CAAAGTGTGTGGTATCTAACCTTATGCCAAGTAGTTTTGAGGCCTGTGAGCCTACTCAGACGATTACGCC
ATTTACTGAAACCAAGCATGTACCGGATTACCAGGTGTGCGAGAAGATCAGCACGCTTACTGAGTGTCAG
TTAGAACGACGTGTATCCGCTGAAACTCATCAACAAAGCTGGTCTATTGAGCGTGGTTGCTTTAGCTCTG
AAACGCTCAGCTTTGTTCCACAGCACAGCAGTACTATGCAAACTGGGAACGCGATACTGAGAATTTTTGA
TAATCAAAATACTGAGATAAAAATTACCGAGTCGCCATCCAAGGCAAATGGTTGGAAAACGACACTCTCA
CTGACGGGCAATAAGGAAACGGTGACTGAGACGAAACCGTCCATTAAATACCCTGAAATGACGTGTCCAA
AAGGAACCTTGGTTGGTTCATTGTGTAAAGTCGCCAATGGGTCGATTATTTCGTGGCATGAACCTCAGGA
AGTTACTCGTTCCAGATGTGAATCCGGCTGGAACAAAGTCGATTTCGATACTTGCAGCCGAGAAGTTCAG
AAGTGTTTGGCTCCTGCGAAACTGAGCGCTTCATTGACCTTCTCTGGCAAGTACTTAGAACAGGACGTTG
TTCATCAATCAAGTGATCCGGGCATAGACCAATGCTTGATGCAAACGGATCAGTTTACTGCCGTGCAGTG
GCAGTGTTTGGATACGGGCACAAAACGAATCGACGGGTTAACGGTTGGTAGTGGCGAGTTGGCCAATCTT
GGGAGCCTTTATCCAGCGGTTGTTTCGTCTCCTGTTCATTTAACCAGTCGCGGCAGCTCTGATGGACTGG
GACTCTCATGCTGGAGGGCAAGAGCAACCTACAATGCTTCGACTGCTCATCCAGAGTTCAACATGGGCAG
CTCAGATAGCTGGGTAGATGCCAATGGTAATACACAAACCATCGTTAATAACGGACAAAACACGACCACC
AATACGTGTGCCGCGCTGGAGCAAAACCTGGCCTGCCAGTACGTCAGAACCGAATGCACTGAAGGCGGGG
CTGGTCATGAAGGCTTCTGCTATATCCAAAGTTTGGTGTATGACTGCGGACAAAGCGTTGAAGTGCAAAA
TGCACGAATGGAAACTCAATACAACTGTGAGGGGCCAGTTCGCTGTATGGGCACAGATTGTTTAGAGCCA
GAGTCAATCAAGCAGGCTAACTTTGCAGAAGCCGCAGCGATGCTTAATGCGGCGCAGTTTATGACCAATG
ATATGTCATGTACGGGAGCTGATGGCCAAGATAACGTCGAGTGTACGGTCTTTAAAGGTAATGCTGGCCA
GTGCAAAAAAGCCGTTGGTGGCATAGTGGATTGCTGTGAAAAGCCAAGTGGCGTGTCGTTATCGGATTAC
ATCACGATGATAGTGGCGGTTAACAAGCTTGATACGGCAGTCATGGCCATGAATCCGTCTTCGGCAATCT
ATGGTTCGTGGAATACGCTCAGGGAACCAATCACCAGTACCTGGAGTGCGGTTAAAGAGCCTTTTGTGTC
TGCATGGGACTCTCTCATGGGGGCTGGGCCATCAACGGCTGCTGGCGCGGGAGCGGAGCAAGCTGCGACT
GGCTTTATGCAGGTGTTGACCAACAAAACGGCTGAGTGGGTAGGCTCTACGTTTGGTTCGGGGGCGCAAT
CGGCACTGTTTAGTAACGTTGGTGGTGCGGTTGGAGCCGATGGTGTCGTTTCGGGTGGTAACTTTGCCCT
GGGGGGCGCTGCGGGCGCGGTTCTGAGTACGGTTATGACGGCCTACATGATTTATTCAGTCACTATGATC
CTCATTCAGCTTATCTGGAAATGTGAGCAGAGCGAGTTTGAAATGAACGCCAAGCGGGTATTGAAGAGTT
GCCACTATGTAGGCTCTTACTGCAAGTCTAAGTTCTTAGGTGCCTGTGTTGAAAAACGGCAGTCATATTG
CTGTTTTACTTCGCCACTTTCACGGATCATTCAAGAACAAGTACGTCCTCAATTGGGCCTTGGTTGGGGC
AGTGCCAAGTCACCAAACTGTGAAGGTTTGACCGCGAGTCAGTTAAACCAGGTAGATTGGAGCCAAGTCA
ATCTCGATGAATGGATAGGTATCTTGTCGATAACAGGCAACCTACCCGAAGTACCGTCACTGGATCTGGA
ACGACTCACAGGCTCAGGAAGTACGCTAAACGTTGATGGAAATCGTCAGAGTGCCGCAGATAGAGCCATT
GAACGGCTAAACGGAATGGATGCACAGAAACTGCGTCAGGAGGCGACGGAAGAAATTTCGGGGAATAATT
GA
 Primer design