SecReT4
Protein ID: 229608770
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003692
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]2992669..2993703 [-]
ProductIncF plasmid conjugative transfer pilus assembly protein TraU
Component typeTraU_F
UniProt IDC3NU31
KEGG IDvcj:VCD_003692
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.5e-69, Aligned region: 45..341
Protein Sequence: 344 a.a.     [Download]
>gi|229608770|ref|YP_002879418.1| IncF plasmid conjugative transfer pilus assembly protein TraU [Vibrio cholerae MJ-1236]
MFMKKLNNTYRLLRTLVVMFVLSASIPAKADLTCPDAGLLSGKLLTDVCWSCIFPIRVAGLPLGSGNVPS
GASNKSFCLCEDNLGVPRPGIVTSMWEPARLIELVRTPGCSPSLGGIRLPLGDRRLQGGHGEGEYDTGDL
AFYHYHYYAFPLLVMLDLFMDGNCNADGYMDFDLMYLSELDPTWLNDELAFFTQPEAAAVANPLAISACT
ADAASSTLGKPIDQLFWCAGSWGHLYPLSGHTLAIGSLAENTSHLAARAIAAQHRRGLARRTMGNSALCR
PVIEPMLPKSQYKMSMFFPVPETESAHVIGESTMKWGEWRTIPGAGEDALYILWRWQDCCNSGG
 
Nucleotide Sequence: 1035 bp     [Download]
>ref|NC_012668.1|:c2993703-2992669 IncF plasmid conjugative transfer pilus assembly protein TraU [Vibrio cholerae MJ-1236]
TTGTTCATGAAAAAGCTCAATAATACGTATCGTCTGTTGCGGACTCTCGTTGTCATGTTTGTCCTAAGCG
CATCTATTCCTGCAAAAGCCGACCTGACCTGCCCAGACGCGGGGTTATTGTCCGGCAAGTTGCTGACGGA
TGTTTGCTGGTCATGCATTTTTCCTATCCGGGTTGCCGGTCTTCCTCTTGGTTCTGGAAATGTCCCAAGC
GGCGCATCAAACAAGTCATTTTGCTTATGTGAAGACAACTTAGGTGTGCCAAGGCCAGGTATTGTTACCA
GCATGTGGGAGCCAGCGCGTCTGATTGAACTGGTCAGAACGCCGGGTTGCTCGCCTTCCCTGGGAGGGAT
TCGTTTACCGTTAGGTGATAGACGACTGCAAGGTGGTCATGGCGAGGGTGAATACGACACCGGTGATCTC
GCTTTCTACCATTACCATTATTACGCCTTTCCGCTTTTGGTCATGCTCGATTTGTTCATGGATGGCAATT
GCAATGCCGATGGTTACATGGACTTTGACTTGATGTATTTGTCGGAATTGGACCCAACATGGCTGAACGA
TGAACTGGCCTTTTTTACTCAGCCTGAAGCTGCTGCCGTTGCCAATCCATTGGCTATTTCGGCTTGTACC
GCTGACGCTGCCTCATCGACGCTTGGTAAACCCATCGACCAGTTGTTTTGGTGTGCTGGCAGTTGGGGCC
ATCTCTATCCCTTATCTGGCCACACCTTAGCCATTGGCTCATTAGCAGAAAACACCAGCCATTTAGCGGC
GCGTGCAATCGCGGCTCAACACAGGCGTGGTCTTGCTAGGCGAACAATGGGGAACAGTGCGCTATGCCGA
CCTGTTATCGAACCCATGCTGCCGAAATCCCAATACAAGATGAGTATGTTCTTCCCTGTACCGGAAACTG
AAAGTGCGCATGTCATCGGTGAAAGCACCATGAAATGGGGAGAGTGGCGAACGATCCCCGGTGCCGGTGA
AGATGCGCTCTACATTTTGTGGCGCTGGCAAGACTGCTGTAACTCGGGAGGTTAA
 Primer design