SecReT4
Protein ID: 229608771
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003693
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]2993681..2994844 [-]
Producthypothetical protein
Component typeTraW_F
UniProt IDC3NU32
KEGG IDvcj:VCD_003693
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.8e-23, Aligned region: 86..202
Protein Sequence: 387 a.a.     [Download]
>gi|229608771|ref|YP_002879419.1| hypothetical protein VCD_003693 [Vibrio cholerae MJ-1236]
MLVALGRFGRRWMMRRLCLLFLLVAPLAWVQVSWAQEPYPLSDEDKKIVEMSRSILQSAVDGSSEFIEPF
SPIEQPASLKHNDEWLIFASSSLGDSSLKQLFKEASATGAIVLFRGIPEGKTLGAAIRDWHTLMTGLDPV
PQVRIDPKAFVHWRVTSVPAIFRIEDDKVTASALGVYSKDWLQRQIETGNTGSLGQRGPIHSILEPDLVQ
VAMQRLQSIDLGALKKKAIERFWSRQTFTELPKATQYRIRTVDPTIVMQRPLLDANGRTLIPAGTRINPL
KALPFTQQLVVFNASNAEEVDAVAHWLEGQDRTLRRITLITTQLDRTQGWNRLNAIEKTLDSPVYLLNAS
LKQRFDLQVTPSFVQAKGLAFEIEEIPAKELVHEKAQ
 
Nucleotide Sequence: 1164 bp     [Download]
>ref|NC_012668.1|:c2994844-2993681 hypothetical protein VCD_003693 [Vibrio cholerae MJ-1236]
TTGTTGGTCGCGCTTGGCCGCTTTGGTAGGAGGTGGATGATGAGAAGACTATGCCTCTTATTTTTGTTGG
TTGCTCCATTGGCTTGGGTTCAAGTTTCCTGGGCACAAGAGCCTTATCCGTTGTCTGATGAGGACAAAAA
GATCGTTGAAATGAGCCGCAGCATTTTACAAAGTGCTGTGGATGGTTCATCTGAATTTATCGAGCCTTTT
TCACCGATTGAACAACCTGCGTCGCTCAAACATAACGATGAATGGTTGATTTTTGCGTCGTCTTCACTGG
GAGATTCCTCACTGAAGCAGCTATTTAAAGAGGCCAGTGCTACCGGCGCTATTGTGTTGTTTCGGGGAAT
TCCTGAAGGAAAGACCTTGGGGGCGGCTATCCGTGATTGGCATACGCTGATGACGGGGCTTGATCCTGTT
CCTCAGGTTCGAATCGATCCGAAAGCCTTTGTGCACTGGCGGGTGACTAGCGTGCCTGCTATTTTCCGCA
TAGAAGATGACAAGGTGACTGCAAGTGCACTAGGGGTTTACAGCAAGGACTGGTTGCAGCGTCAAATTGA
AACAGGCAATACCGGTTCATTGGGTCAACGCGGTCCTATTCATTCGATTTTAGAACCGGATTTGGTGCAA
GTAGCGATGCAGCGTTTACAGTCGATTGACTTGGGCGCGTTAAAGAAAAAAGCCATTGAGCGTTTCTGGT
CTCGCCAAACATTTACTGAGTTACCCAAAGCCACGCAGTATCGGATAAGAACGGTTGATCCAACCATCGT
CATGCAGCGGCCACTATTGGATGCCAATGGCCGAACATTGATCCCAGCGGGAACGCGTATTAACCCGCTA
AAAGCCTTGCCATTTACTCAGCAGCTCGTGGTGTTTAATGCGTCGAACGCTGAAGAAGTGGACGCAGTAG
CGCATTGGCTTGAGGGCCAAGATAGGACACTGCGCCGCATTACGCTTATCACCACGCAGCTCGACCGTAC
TCAAGGCTGGAATCGCCTCAATGCGATAGAAAAGACATTGGACAGTCCGGTTTATCTTCTCAATGCCTCG
CTAAAGCAGCGCTTTGATTTGCAAGTCACCCCATCGTTTGTTCAAGCAAAGGGACTCGCGTTTGAAATAG
AAGAAATTCCAGCAAAGGAGCTTGTTCATGAAAAAGCTCAATAA
 Primer design