SecReT4
Protein ID: 229608774
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003696
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]2995652..2998069 [-]
ProductIncF plasmid conjugative transfer pilus assembly protein TraC
Component typeTraC_F
UniProt IDC3NU35
KEGG IDvcj:VCD_003696
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.8e-57, Aligned region: 443..719
TraC_F_IV [PF11130], Evalue: 1.1e-53, Aligned region: 15..248
Protein Sequence: 805 a.a.     [Download]
>gi|229608774|ref|YP_002879422.1| IncF plasmid conjugative transfer pilus assembly protein TraC [Vibrio cholerae MJ-1236]
MVGGALMKASLYSGQRASELLPVLAYSDDEQLFFMEDQSVGFGFLCDPLPGGDESVADRVNVLLNNDWPK
DTLLQFGLYASPDIQTDLQRMMGLRHRQSDPLLRASIRKRADFLDGGTVQPIEESTQTQVRNFQLIVTCK
LPLESPIPTERELSRASALRASFSQALATVGFRVTEMTDRNWLAAISAQLNWGKDASWRNPSPIRSEADK
PLREQVLDYDRAIKVDSQGLMLGDYRVKTLSFKRLPERIWFGHAASFAGDMMTGSRGLRGSFLLNVTIHF
PSAEAMRSRLETKRQWAVNQAYGPMLKFVPVLAAKKKGFDVLFEALQEGDRPIRANMTLTLFSPTGEASI
SSVSNARTYFKELGFELMEDKYFCLPIFLNALPFGADRQAMNDLFRFKTMATRHVIPLLPLFADWKGTGT
PVINFVSRNGQIMSVSLYDSGSNYNCCIAAQSGSGKSFLVNEIISSYLSEGGQCWVIDVGRSYEKLCEVY
DGEFLQFGRNSGICLNPFEIVEDYDEEADVLVGLLAAMAAPTQSLTDFQMANLKRQTRELWEKKGRAMLV
DDVAEALKNHEDRRVQDVGEQLYPFTTQGEYGRFFNGHNNIRFKNRFTVLELEELKGRKHLQQVVLLQLI
YQIQQEMYLGERDRRKIVFIDEAWDLLTQGDVGKFIETGYRRFRKYGGSAVTVTQSVNDLYDSPTGKAIA
ENSANMYLLGQKAETINALKKEGRLPLGEGGYEYLKTVHTVTGVYSEIFFITEMGTGIGRLIVDPFHKLL
YSSRAEDVNAIKQLTRKGLSVADAISQLLKERGYE
 
Nucleotide Sequence: 2418 bp     [Download]
>ref|NC_012668.1|:c2998069-2995652 IncF plasmid conjugative transfer pilus assembly protein TraC [Vibrio cholerae MJ-1236]
TTGGTTGGAGGGGCGTTAATGAAAGCCTCTCTGTATTCAGGGCAACGCGCTTCAGAGCTATTGCCAGTAT
TGGCCTATTCAGACGATGAGCAACTGTTTTTCATGGAAGACCAAAGTGTTGGCTTTGGTTTTCTATGTGA
CCCATTGCCGGGTGGTGATGAGTCTGTTGCAGACAGGGTTAATGTTCTTCTCAACAACGACTGGCCAAAA
GACACTTTGCTGCAATTTGGCCTGTACGCCTCGCCTGATATTCAAACCGACCTTCAGCGCATGATGGGCT
TACGGCATCGTCAATCCGATCCATTGCTTAGGGCGTCGATACGCAAACGTGCGGATTTTCTCGATGGGGG
CACGGTTCAACCGATAGAAGAATCGACCCAGACTCAGGTTCGCAACTTTCAACTGATCGTCACCTGCAAA
TTGCCTTTGGAAAGTCCTATACCGACGGAGCGTGAGTTGAGTCGAGCATCCGCGCTTCGGGCTTCTTTCT
CGCAAGCGCTGGCAACGGTTGGTTTTCGCGTCACTGAGATGACTGACCGAAACTGGCTCGCGGCAATAAG
TGCTCAGCTTAACTGGGGAAAAGATGCTTCCTGGCGCAATCCATCACCAATCCGCAGTGAGGCAGATAAA
CCACTTCGGGAGCAAGTGTTGGATTATGACCGAGCTATCAAGGTGGATAGCCAAGGTCTGATGCTGGGCG
ATTACCGAGTTAAAACCTTATCGTTTAAACGCTTGCCTGAGCGGATCTGGTTTGGTCATGCCGCAAGTTT
TGCGGGCGATATGATGACGGGCAGTCGCGGTTTACGCGGCAGCTTTTTGCTAAATGTCACCATTCACTTT
CCCTCAGCTGAGGCGATGAGATCTCGTTTAGAGACGAAGCGTCAGTGGGCGGTCAATCAGGCCTATGGCC
CGATGCTCAAGTTTGTGCCGGTGCTTGCAGCCAAGAAAAAGGGATTTGATGTTCTTTTTGAAGCTTTGCA
AGAAGGTGATCGTCCTATTCGGGCCAATATGACTTTGACGCTGTTTTCACCAACGGGAGAAGCGTCCATC
AGCTCTGTTTCAAATGCTCGAACTTATTTCAAAGAACTCGGATTTGAGCTGATGGAAGACAAGTACTTCT
GTTTGCCCATTTTCCTGAATGCCTTGCCATTTGGTGCTGACCGCCAGGCGATGAACGACTTGTTTCGATT
CAAGACCATGGCGACACGGCATGTCATCCCTCTGTTGCCTTTATTTGCGGATTGGAAAGGCACTGGCACG
CCGGTGATTAACTTTGTTTCCCGTAATGGCCAGATCATGAGTGTGTCCCTTTATGACTCGGGCAGTAATT
ACAATTGTTGCATCGCGGCGCAATCGGGATCGGGTAAGTCATTCCTGGTGAACGAAATCATCTCCTCCTA
CCTATCAGAAGGCGGGCAATGCTGGGTGATTGATGTTGGCCGCTCTTATGAAAAGCTGTGTGAAGTCTAT
GACGGTGAGTTCTTACAGTTCGGGCGAAACAGTGGCATTTGCTTAAATCCGTTTGAAATCGTTGAGGACT
ATGACGAAGAAGCGGATGTGTTGGTTGGGTTATTGGCCGCAATGGCCGCACCTACGCAGTCATTAACCGA
TTTTCAGATGGCAAACCTAAAGCGTCAGACCCGTGAACTGTGGGAGAAAAAAGGTCGTGCCATGTTGGTT
GATGATGTGGCAGAGGCCTTGAAAAATCACGAAGACCGACGTGTGCAAGACGTGGGTGAGCAGCTCTATC
CATTTACGACACAGGGCGAATATGGCCGCTTCTTTAATGGCCACAATAATATTCGCTTCAAAAACCGTTT
CACCGTTCTGGAGTTAGAAGAGCTCAAGGGGCGTAAGCATCTACAACAAGTGGTGTTGCTTCAGCTTATC
TACCAAATCCAACAAGAGATGTACTTAGGTGAGCGGGATCGTCGCAAGATTGTGTTCATCGACGAAGCCT
GGGATCTGCTGACTCAAGGTGATGTCGGTAAATTTATCGAAACGGGTTACCGGCGATTTCGAAAATATGG
TGGCAGTGCTGTAACGGTAACGCAATCGGTCAACGATTTGTATGATAGCCCTACAGGTAAAGCCATCGCT
GAAAACTCAGCCAATATGTACCTGCTTGGTCAAAAAGCTGAAACCATCAACGCGCTCAAAAAAGAAGGCC
GCTTGCCACTAGGTGAAGGCGGCTATGAATACCTGAAAACGGTTCATACCGTCACTGGTGTCTATTCCGA
AATTTTCTTTATTACCGAAATGGGCACCGGGATTGGCCGCCTCATCGTCGATCCGTTTCACAAGCTGTTG
TACTCGTCCCGTGCAGAAGATGTAAACGCGATTAAACAGTTAACGCGCAAAGGCCTTTCTGTTGCTGATG
CCATCTCTCAGTTGTTGAAGGAGCGAGGCTATGAATAA
 Primer design