SecReT4
Protein ID: 229608782
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003704
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]3008223..3008609 [-]
ProductTraA
Component typeTraA_F
UniProt IDC3NU43
KEGG IDvcj:VCD_003704
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.7e-06, Aligned region: 7..92
Protein Sequence: 128 a.a.     [Download]
>gi|229608782|ref|YP_002879430.1| TraA [Vibrio cholerae MJ-1236]
MTNAVRTIQTQRLMTIGALGLMALMISEPSFAGTGGDAFTDVWDTLKDWTQGTLGRIVAGAMVLVGIVGG
IARQSLMAFALGIGGGMGLYNTPTVVESVMSATLPVVASTQEVIGTTVPAISAVLLGT
 
Nucleotide Sequence: 387 bp     [Download]
>ref|NC_012668.1|:c3008609-3008223 TraA [Vibrio cholerae MJ-1236]
ATGACAAATGCAGTTCGCACCATTCAAACTCAGCGCCTAATGACCATTGGTGCGCTTGGTTTAATGGCGT
TAATGATTTCGGAGCCCTCATTTGCGGGCACCGGTGGTGATGCTTTCACCGATGTGTGGGATACCCTAAA
AGATTGGACCCAAGGTACTTTGGGACGGATCGTAGCGGGAGCCATGGTTCTGGTGGGTATTGTGGGCGGT
ATCGCTCGCCAAAGCTTGATGGCTTTTGCCTTGGGCATTGGTGGCGGTATGGGTCTCTACAATACGCCAA
CCGTCGTTGAAAGTGTTATGTCTGCAACCTTACCTGTTGTTGCCAGCACTCAAGAAGTTATTGGCACAAC
TGTTCCAGCAATCAGCGCCGTTTTACTGGGCACCTGA
 Primer design