SecReT4
Protein ID: 229608783
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003705
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]3008606..3009256 [-]
Productconjugative transfer protein TraV
Component typeTraV_F
UniProt IDC3NU44
KEGG IDvcj:VCD_003705
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 3.6e-20, Aligned region: 67..173
Protein Sequence: 216 a.a.     [Download]
>gi|229608783|ref|YP_002879431.1| conjugative transfer protein TraV [Vibrio cholerae MJ-1236]
MKKSCMLLTDRSPFQTIRCVSRGELTMTTSMQNNPKHQSKQWSKAGLLLLAVGSTLLSGCSSLGLGSSEY
GCPGMPDGVRCLSAREVYELTSNGAAPKTIDAVATRIGAPSGYSQSDLETGLLSHPALPETQQSAPIRIP
SRVMRIWIAPWEDDRGDLNLSSYVFTEIEPRRWDIGVSAPRTVSPVLRPLQTQSDSASAGADGKRDNLSI
YGETNE
 
Nucleotide Sequence: 651 bp     [Download]
>ref|NC_012668.1|:c3009256-3008606 conjugative transfer protein TraV [Vibrio cholerae MJ-1236]
ATGAAAAAATCCTGCATGTTGCTGACCGATCGAAGTCCGTTTCAGACAATAAGATGTGTATCCAGAGGAG
AGTTAACCATGACGACATCAATGCAGAACAACCCAAAGCACCAGTCAAAACAGTGGTCTAAAGCTGGATT
ACTTTTATTGGCAGTCGGCTCAACCTTATTGTCTGGCTGTAGTTCATTGGGTCTTGGGAGTAGTGAATAT
GGATGCCCAGGTATGCCTGACGGTGTGCGCTGTTTATCCGCTCGTGAAGTCTATGAGCTTACCAGTAATG
GCGCTGCACCCAAGACGATTGATGCTGTGGCGACTCGAATTGGTGCTCCCTCTGGGTATTCACAATCTGA
TTTAGAGACAGGACTGCTGAGCCATCCAGCATTACCCGAGACGCAGCAATCTGCACCTATTCGCATTCCT
TCAAGGGTAATGCGGATTTGGATTGCGCCTTGGGAGGATGACCGTGGGGATCTGAATTTATCCAGCTACG
TGTTTACCGAAATTGAACCGCGCCGGTGGGATATTGGGGTGTCAGCACCTCGAACGGTTTCGCCAGTGCT
ACGTCCACTTCAGACTCAAAGCGATTCAGCCTCAGCGGGAGCTGATGGTAAGCGCGATAACTTGAGTATC
TACGGAGAAACTAACGAATGA
 Primer design