SecReT4
Protein ID: 229608784
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003706
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]3009253..3010545 [-]
ProductIncF plasmid conjugative transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDC3NU45
KEGG IDvcj:VCD_003706
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 8.3e-51, Aligned region: 213..417
Protein Sequence: 430 a.a.     [Download]
>gi|229608784|ref|YP_002879432.1| IncF plasmid conjugative transfer pilus assembly protein TraB [Vibrio cholerae MJ-1236]
MMKAQWEQMSPNMKRGLSVAGIAGGLILMVMVFSPNPDDGASSRNRQETIRHILTDTNTRDVGVDSLAAN
VKLLSERNEQLRREVERLRRDVDSGRLSPGSPSIPSEVNAELARLRAELDDVRAGGDSAVEGTNSRFEVP
LSAMELPKEEKPLPSNPDDYFANAPLPDPLYQQTANGQGARARDVPLPPITIRMIEPEVVAEPEVVVQEA
PPLYLPAGSIISGTLITGLDAPTHESARREPFPALLRIQKEAILPNRFRADIKECFLIAAGYGDLSSERA
YLRGETISCVREDGGVIETRLDSYAVGEDGKAGIRGRLVSKQGQLVAKSMMAGFLQGLAGAFDVNPVPTI
QTGNAGDTQLYQQVMSQEALQGAAIKGTGKALDRVAKFYLDMAENMFPVIEVDAARKIEVIVTRGASLSL
ATSQGGGARR
 
Nucleotide Sequence: 1293 bp     [Download]
>ref|NC_012668.1|:c3010545-3009253 IncF plasmid conjugative transfer pilus assembly protein TraB [Vibrio cholerae MJ-1236]
TTGATGAAAGCACAATGGGAACAAATGAGCCCGAATATGAAGCGGGGCCTATCGGTTGCTGGAATTGCTG
GTGGTCTCATTCTTATGGTGATGGTGTTTTCACCTAATCCTGATGATGGCGCGAGCAGTCGGAACCGACA
GGAAACGATCCGGCACATTCTTACGGATACCAATACTCGTGATGTTGGGGTCGATAGTTTGGCTGCGAAC
GTAAAACTACTCAGTGAGCGCAACGAGCAGTTACGCCGCGAAGTTGAACGCTTGCGTCGTGACGTTGACT
CAGGACGGTTAAGCCCTGGTTCGCCTTCTATACCAAGTGAGGTCAATGCGGAGTTGGCTCGTCTTCGAGC
GGAACTTGATGATGTTCGCGCTGGAGGTGATTCAGCAGTTGAAGGCACAAATAGCCGTTTTGAAGTGCCT
TTATCTGCCATGGAATTGCCTAAAGAAGAAAAGCCACTGCCGTCTAACCCAGACGACTATTTTGCCAATG
CGCCGCTGCCTGATCCGCTCTATCAGCAGACAGCCAATGGCCAAGGTGCACGAGCTCGGGATGTTCCATT
GCCGCCAATCACGATTCGTATGATTGAGCCTGAAGTGGTTGCCGAACCAGAGGTTGTTGTGCAAGAAGCG
CCGCCTTTGTATCTACCGGCGGGCAGCATCATCTCAGGTACTTTGATCACAGGTTTGGATGCCCCTACTC
ACGAGTCCGCAAGACGCGAACCTTTTCCTGCATTGCTGAGGATTCAAAAGGAAGCCATTTTACCCAACCG
ATTTAGAGCGGATATCAAAGAGTGTTTCTTGATCGCCGCAGGTTACGGTGATTTGAGCTCTGAGCGAGCT
TATTTGCGAGGCGAGACCATTTCATGTGTGAGAGAAGATGGTGGCGTCATTGAAACACGACTGGATTCTT
ATGCCGTAGGTGAAGACGGCAAAGCCGGTATTCGTGGCCGATTAGTGTCGAAACAAGGCCAACTGGTGGC
CAAATCGATGATGGCCGGATTCCTTCAGGGCTTGGCAGGCGCATTTGATGTGAATCCTGTACCAACGATT
CAGACGGGTAATGCCGGTGATACTCAGCTGTACCAGCAAGTCATGAGCCAAGAAGCATTACAAGGTGCTG
CAATTAAAGGCACTGGTAAAGCATTGGATCGAGTGGCCAAGTTCTATCTGGACATGGCTGAAAATATGTT
CCCAGTCATAGAGGTAGACGCTGCAAGGAAAATTGAAGTCATAGTCACTCGTGGGGCCTCGTTGTCGTTG
GCCACTTCGCAAGGGGGAGGTGCAAGAAGATGA
 Primer design