SecReT4
Protein ID: 229608785
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003707
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]3010542..3011444 [-]
ProductIncF plasmid conjugative transfer pilus assembly protein TraK
Component typeTraK_F
UniProt IDC3NU46
KEGG IDvcj:VCD_003707
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.6e-18, Aligned region: 37..277
Protein Sequence: 300 a.a.     [Download]
>gi|229608785|ref|YP_002879433.1| IncF plasmid conjugative transfer pilus assembly protein TraK [Vibrio cholerae MJ-1236]
MMRTKISRLMTPGLIAMCLSGVLLSQASYADVELPIVSASVMKQSATANPPIQTNTVSTDVPTTLLMTPG
VNELIPVALGHLNRIVTPFESPQVRTTSDAQTQIKGNVVYVATDKESPVSLYITPPGQEAPALSVTLVPR
RIPPREITLAIDGQQWPIKGVVNRKAATWETAQPYVDSLRDLLRHLALNELPQGYDIRLAGQTDTSPKCF
QPGLKFGFKQGQIVTGHYFTVYVGLVESFADEPIEASEIACHAPDIVASAYWPRNILLPGEKTELYVVVR
NHREEAVESQRPSLLVGGEL
 
Nucleotide Sequence: 903 bp     [Download]
>ref|NC_012668.1|:c3011444-3010542 IncF plasmid conjugative transfer pilus assembly protein TraK [Vibrio cholerae MJ-1236]
ATGATGCGAACCAAAATTAGTCGATTGATGACGCCAGGCTTAATCGCAATGTGCTTGAGTGGCGTCCTGT
TATCTCAAGCGTCGTATGCAGACGTGGAATTGCCGATTGTGTCAGCCAGTGTGATGAAGCAGTCCGCTAC
AGCAAATCCACCGATTCAAACCAATACGGTTTCAACGGATGTGCCAACAACGCTACTGATGACACCGGGG
GTTAATGAACTGATCCCTGTAGCACTTGGTCATCTGAATCGGATTGTGACGCCGTTTGAATCGCCTCAGG
TGAGAACAACCAGTGATGCTCAGACGCAAATCAAGGGGAATGTTGTATATGTGGCCACGGACAAAGAATC
ACCGGTTTCACTTTACATCACTCCGCCTGGTCAGGAAGCGCCCGCATTATCTGTCACCTTAGTACCTCGT
CGTATTCCACCGCGTGAAATCACCTTAGCTATTGATGGTCAGCAGTGGCCTATTAAGGGCGTCGTGAACC
GAAAAGCCGCCACTTGGGAAACGGCTCAGCCATACGTCGATAGCTTACGTGACTTGCTCAGACACCTTGC
ACTAAATGAGTTACCTCAAGGCTATGACATCCGTTTAGCTGGCCAAACCGACACAAGCCCTAAATGTTTT
CAGCCAGGCTTAAAGTTTGGTTTTAAGCAGGGGCAAATTGTGACGGGACATTACTTCACCGTCTATGTAG
GACTGGTTGAAAGCTTTGCCGATGAGCCGATAGAAGCCAGTGAGATAGCCTGTCACGCACCAGATATAGT
GGCAAGTGCTTACTGGCCGCGCAATATCTTGTTGCCGGGTGAAAAGACTGAGTTGTATGTGGTTGTACGC
AATCATCGTGAAGAAGCAGTGGAAAGTCAGCGACCTTCGCTTCTTGTGGGAGGTGAGCTTTGA
 Primer design