SecReT4
Protein ID: 229608786
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003708
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]3011425..3012051 [-]
Producthypothetical protein
Component typeTraE_F
UniProt IDC3NU47
KEGG IDvcj:VCD_003708
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 2.3e-16, Aligned region: 22..175
Protein Sequence: 208 a.a.     [Download]
>gi|229608786|ref|YP_002879434.1| hypothetical protein VCD_003708 [Vibrio cholerae MJ-1236]
MKFDVFLKSWQGTQLENRWQRFLIAVLVLSNLLLAVAAFSRNTVVAIQPPTLSEPAEVSRNQATQPYLES
WGLYLAELMGNVTPGNVSFIRVAIEPLLSPAVYQQVVDALEIQARQIREDRVTLKFQPRQVEYEYETGHV
FVTGYSLVSGPSGDEQRQTRTYEFDIDIEQYRPKLSWMDTYEGQARTKRVREKLTQEQNRRVNDANQN
 
Nucleotide Sequence: 627 bp     [Download]
>ref|NC_012668.1|:c3012051-3011425 hypothetical protein VCD_003708 [Vibrio cholerae MJ-1236]
GTGAAGTTCGACGTGTTTTTAAAATCATGGCAAGGCACGCAATTAGAGAACCGATGGCAGCGGTTCCTGA
TTGCAGTGCTGGTGCTATCTAATTTGCTGCTTGCGGTAGCGGCATTTTCTCGCAATACCGTGGTAGCCAT
TCAACCACCAACTTTGTCTGAACCGGCTGAAGTGTCACGAAACCAAGCCACTCAACCTTACCTTGAATCC
TGGGGACTCTACCTGGCTGAGCTTATGGGTAACGTGACGCCAGGTAATGTGTCTTTCATCCGGGTTGCCA
TTGAGCCGCTACTTTCTCCAGCGGTGTACCAGCAAGTGGTCGATGCACTGGAGATTCAGGCAAGACAAAT
CCGCGAAGACCGGGTCACGCTCAAATTCCAACCCAGACAAGTGGAATATGAGTATGAAACCGGCCATGTC
TTTGTGACCGGTTATTCCTTGGTTTCTGGGCCATCTGGAGATGAGCAGCGCCAAACTCGCACCTATGAGT
TTGACATCGATATTGAGCAATACCGTCCAAAACTTAGCTGGATGGATACGTATGAGGGGCAAGCTAGAAC
GAAGCGCGTTCGTGAAAAGTTGACCCAAGAGCAAAACCGGAGGGTGAATGATGCGAACCAAAATTAG
 Primer design