SecReT4
Protein ID: 229608787
T4SS name [ID]Tra_F [583]
Gene symbol-
Locus tagVCD_003709
StrainVibrio cholerae MJ-1236
Repliconchromosome 1 [GenBank: NC_012668] [Browse all T4SS(s) in this replicon]
Location [Strand]3012048..3012335 [-]
ProductIncF plasmid conjugative transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDC3NU48
KEGG IDvcj:VCD_003709
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.5e-16, Aligned region: 6..94
Protein Sequence: 95 a.a.     [Download]
>gi|229608787|ref|YP_002879435.1| IncF plasmid conjugative transfer pilus assembly protein TraL [Vibrio cholerae MJ-1236]
MTMEPVNIPSYIDDPPHFLLWSADEMAPILLGLVIGIFTGNALVLCLLGLVTTKLYRRFRDGRPDGFILH
AIYWAGLLPTKAKTIPNPFIRSYLP
 
Nucleotide Sequence: 288 bp     [Download]
>ref|NC_012668.1|:c3012335-3012048 IncF plasmid conjugative transfer pilus assembly protein TraL [Vibrio cholerae MJ-1236]
GTGACTATGGAACCTGTAAATATTCCATCCTATATCGATGACCCGCCGCACTTCCTGCTTTGGAGTGCCG
ATGAGATGGCTCCCATTCTGTTGGGGCTAGTGATCGGCATTTTTACCGGTAATGCCTTGGTTTTATGCCT
GTTGGGGTTGGTAACAACCAAGCTCTATCGGCGTTTTCGTGATGGCCGCCCAGATGGTTTTATTCTTCAC
GCCATCTACTGGGCTGGACTGTTGCCCACCAAGGCCAAGACGATCCCTAACCCATTTATCAGGAGCTATC
TGCCGTGA
 Primer design