SecReT4
Protein ID: 23499826
T4SS name [ID]VirB [378]
Gene symbol-
Locus tagBRA0059
StrainBrucella suis 1330
Repliconchromosome II [GenBank: NC_004311] [Browse all T4SS(s) in this replicon]
Location [Strand]56802..57887 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDQ8FXK7
KEGG IDbms:BRA0059, bsi:BS1330_II0059
PDB ID2GZA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.1e-66, Aligned region: 26..328
Protein Sequence: 361 a.a.     [Download]
>gi|23499826|ref|NP_699266.1| type IV secretion system protein VirB11 [Brucella suis 1330]
MMSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHL
ISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKH
VRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIED
VPELFLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGEAYDFINVAASGHGGS
ITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTK
RALSLQHSEKT
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|56968493|ref|NC_004311.2|:c57887-56802 Brucella suis 1330 chromosome II, complete sequence
ATGATGTCAAACCGAAGTGACTTTATTGTGCCTGACGAGGCGGCCGTCAAACGGGCGGCCTCGGTCAATT
TCCATCTGGAACCGCTGCGCCCTTGGTTGGACGATCCGCAGATCACCGAAGTTTGCGTGAACCGGCCGGG
CGAAGTGTTCTGCGAGCGAGCAAGCGCGTGGGAATACTATGCGGTGCCAAACCTCGACTATGAACACCTG
ATTTCGCTGGGAACCGCCACCGCGCGGTTTGTGGATCAGGATATTTCGGACAGCCGACCGGTGCTGTCTG
CGATCCTGCCGATGGGTGAGCGCATTCAGATTGTGCGCCCGCCCGCATGTGAGCACGGCACCATCTCGGT
GACGATCCGCAAGCCGTCTTTCACCCGGCGCACACTGGAAGACTATGCGCAGCAGGGCTTTTTCAAACAC
GTCAGACCCATGAGTAAGAGCCTGACGCCGTTTGAACAGGAACTGCTCGCATTGAAGGAAGCTGGTGATT
ACATGAGCTTCCTGCGGCGGGCGGTACAGCTTGAAAGGGTGATCGTCGTCGCCGGCGAGACGGGATCAGG
CAAGACCACACTGATGAAAGCGCTGATGCAGGAAATTCCGTTCGATCAGCGCCTGATCACCATCGAGGAC
GTACCGGAGTTGTTCTTGCCGGACCATCCGAACCACGTCCACCTGTTTTATCCGAGCGAAGCGAAGGAAG
AAGAAAACGCACCAGTGACGGCCGCCACGCTACTGCGGAGCTGCCTGCGCATGAAACCGACGCGCATCCT
GCTTGCCGAGCTGCGCGGCGGCGAGGCTTACGATTTCATCAACGTGGCCGCGTCCGGCCATGGCGGCAGC
ATCACCAGTTGCCATGCCGGTTCGTGCGAACTGACTTTCGAGCGGCTGGCATTGATGGTGTTGCAGAACC
GCCAGGGCCGCCAGTTGCCATACGAGATCATCCGCCGGCTGCTCTATCTGGTGGTGGATGTCGTCGTGCA
CGTCCACAATGGCGTGCACGACGGCACTGGCCGCCATATATCTGAAGTTTGGTACGACCCGAATACAAAA
CGGGCACTGTCACTGCAACACAGTGAGAAGACGTAA
 Primer design