SecReT4
Protein ID: 23499829
T4SS name [ID]VirB [378]
Gene symbol-
Locus tagBRA0062
StrainBrucella suis 1330
Repliconchromosome II [GenBank: NC_004311] [Browse all T4SS(s) in this replicon]
Location [Strand]59906..60625 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDQ7CEG3
KEGG IDbms:BRA0062, bsi:BS1330_II0062
PDB ID2BHM
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.3e-64, Aligned region: 26..234
Protein Sequence: 239 a.a.     [Download]
>gi|23499829|ref|NP_699269.1| type IV secretion system protein VirB8 [Brucella suis 1330]
MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGIGIAGMLPLKQ
HVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQS
YASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPS
LMSESARLTNPLGFNVTSYRVDPEMGVVQ
 
Nucleotide Sequence: 720 bp     [Download]
>gi|56968493|ref|NC_004311.2|:c60625-59906 Brucella suis 1330 chromosome II, complete sequence
ATGTTTGGACGCAAACAATCTCCACAGAAATCAGTAAAGAACGGGCAGGGCAATGCGCCTTCGGTATATG
ACGAAGCGTTGAACTGGGAGGCCGCGCACGTCCGGCTGGTCGAAAAATCCGAACGCCGCGCGTGGAAAAT
CGCCGGGGCTTTCGGCACCATTACCGTGCTGCTCGGGATCGGCATCGCCGGGATGTTACCGCTAAAGCAA
CATGTGCCCTACCTGGTGCGCGTCAACGCACAGACAGGTGCGCCTGATATCCTGACCTCGCTCGACGAGA
AGAGTGTCAGCTACGACACTGTAATGGATAAATACTGGCTCTCGCAGTACGTGATAGCGCGTGAAACCTA
CGACTGGTACACGCTGCAAAAGGACTACGAAACCGTAGGCATGTTGTCGTCGCCGTCCGAAGGGCAGAGC
TATGCAAGCCAGTTCCAGGGCGATAAGGCGCTTGACAAGCAATATGGCTCAAATGTGCGCACATCGGTAA
CGATCGTAAGCATCGTGCCGAACGGCAAGGGCATCGGCACGGTGCGCTTTGCGAAGACGACAAAGCGCAC
CAACGAGACCGGTGACGGCGAAACAACGCACTGGATCGCCACCATTGGCTACCAATACGTCAATCCCTCT
TTGATGTCGGAATCGGCCCGCCTGACAAACCCGCTGGGTTTCAATGTCACGAGCTATCGCGTTGATCCAG
AAATGGGAGTGGTGCAATGA
 Primer design