SecReT4
Protein ID: 23499830
T4SS name [ID]VirB [378]
Gene symbol-
Locus tagBRA0063
StrainBrucella suis 1330
Repliconchromosome II [GenBank: NC_004311] [Browse all T4SS(s) in this replicon]
Location [Strand]60628..60801 [-]
Producttype IV secretion system protein VirB7
Component typeVirB7
UniProt IDQ7CEG2
KEGG IDbms:BRA0063, bsi:BS1330_II0063
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 57 a.a.     [Download]
>gi|23499830|ref|NP_699270.1| type IV secretion system protein VirB7 [Brucella suis 1330]
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
 
Nucleotide Sequence: 174 bp     [Download]
>gi|56968493|ref|NC_004311.2|:c60801-60628 Brucella suis 1330 chromosome II, complete sequence
ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCGGCCG
TGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGC
TCAGCCTAACCCCGTTGACACTTACGAGGACTAA
 Primer design