SecReT4
Protein ID: 237797179
T4SS name [ID]VirB [382]
Gene symboltraB
Locus tagpNAH20_p73
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]63478..65034 [+]
Productputative TraB protein
Component typeVirD4
UniProt IDC3KFS2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 4e-124, Aligned region: 125..499
TraG-D_C [PF12696], Evalue: 2.2e-20, Aligned region: 363..480
T4SS-DNA_transf [PF02534], Evalue: 3.7e-18, Aligned region: 284..487
AAA_10 [PF12846], Evalue: 4.3e-10, Aligned region: 139..185
Protein Sequence: 518 a.a.     [Download]
>gi|237797179|ref|YP_002887473.1| putative TraB protein [Pseudomonas fluorescens]
MHKREVDSAVMTAGFGLPIAGWAAGVYLAQMPLTPFPAAFKETLHNGWQNPIVLGATIATSAVAASLVYY
LYEYCDDGFRGEQYQEFLRGSEIKNWHTVKAKVRRRNEKTNRERKKRGLAKSEPVMIGKLPMPLHLEDRN
TMICASIGAGKSVTMEGMIASALKRGDRMAVVDPNGTFYSKFSFKGDYILNPFDARSAGWTIFNEIRGIH
DFNRMAKSIIPPQVDPSDEQWCAYARDVLSDTMRKLKETNNPNQDTLVNLLVREDGDTIRAFLANTDSEG
YFRDNAEKAIASIQFMMNKYIRPLRYMSKGDFSIYQWVNDPNAGNLFITWREDMRDTMKPLVATWIDTIC
ATILSSEPMTGKRLWLFLDELQSLGKLESFVPAATKGRKHGLRMVGSLQDWSQLNASYGRDDAETLLSCF
RNYVILAAANAKNAGMASEILGSHDVKRWRKSYTAGKLTRTEEVTRDEPVVQASEISNLPDLVAYVKFGE
DFPITKVKTPYIDYKERAQAIMITGQAA
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|237797106|ref|NC_012674.1|:63478-65034 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGCATAAAAGAGAAGTCGATTCTGCAGTGATGACAGCGGGTTTCGGTTTGCCGATCGCTGGATGGGCAG
CAGGCGTTTATTTGGCACAGATGCCGTTGACGCCATTCCCTGCAGCGTTCAAGGAAACGCTTCACAACGG
CTGGCAGAACCCGATTGTACTGGGGGCCACAATTGCCACGTCAGCGGTCGCCGCTTCGCTGGTTTATTAC
CTGTACGAGTATTGTGACGATGGGTTCCGGGGCGAGCAGTACCAGGAATTTTTGCGGGGCTCGGAGATAA
AAAACTGGCATACCGTCAAGGCAAAGGTGCGCCGCCGTAACGAGAAGACGAATCGCGAGCGGAAAAAGCG
AGGGTTGGCCAAGTCTGAGCCGGTCATGATTGGCAAGCTGCCTATGCCTCTGCACCTTGAAGATCGAAAC
ACGATGATCTGCGCGTCTATCGGTGCCGGTAAGTCGGTGACCATGGAAGGCATGATCGCCTCGGCATTGA
AGCGTGGTGATCGCATGGCCGTTGTCGACCCAAACGGCACGTTCTATTCGAAATTCAGTTTCAAAGGCGA
TTACATTCTCAACCCATTCGACGCCCGCTCCGCTGGCTGGACCATCTTCAACGAGATCCGTGGCATCCAT
GACTTCAACCGGATGGCCAAGTCGATAATCCCGCCCCAGGTCGACCCGAGTGACGAGCAATGGTGCGCGT
ACGCTCGCGACGTATTGTCCGACACCATGCGCAAGCTGAAAGAAACCAACAACCCGAACCAAGACACGCT
GGTGAATTTGCTGGTGCGGGAGGATGGCGACACCATCCGCGCTTTCCTGGCCAACACGGACTCCGAGGGC
TACTTCCGCGACAACGCAGAGAAGGCAATCGCCAGCATCCAGTTCATGATGAACAAATACATTCGTCCGC
TGCGCTACATGAGCAAGGGCGATTTTTCCATCTACCAATGGGTGAACGATCCTAATGCCGGCAATCTGTT
CATCACTTGGCGGGAGGACATGCGGGACACCATGAAACCACTGGTGGCCACGTGGATTGACACCATCTGT
GCAACGATCCTCAGCTCAGAGCCGATGACAGGCAAACGGCTATGGCTGTTCCTCGACGAGCTGCAGTCCC
TCGGCAAACTGGAAAGCTTCGTTCCTGCGGCGACCAAAGGGCGGAAACATGGTCTGCGTATGGTCGGCAG
CCTGCAGGATTGGTCGCAACTCAACGCCAGTTATGGCCGTGACGATGCGGAAACGCTGCTTTCGTGCTTC
CGAAATTACGTCATTCTTGCTGCAGCGAACGCCAAGAACGCAGGCATGGCCAGCGAAATCCTCGGCTCTC
ACGATGTTAAGCGTTGGCGGAAATCCTACACCGCGGGCAAGTTGACCAGGACCGAGGAAGTCACGCGGGA
TGAGCCGGTGGTTCAGGCTTCTGAAATCTCCAACCTTCCAGATCTGGTCGCCTACGTGAAATTCGGTGAA
GACTTCCCGATCACCAAGGTAAAGACGCCGTACATTGATTACAAAGAGCGCGCCCAGGCAATCATGATAA
CCGGTCAAGCCGCGTAA
 Primer design