SecReT4
Protein ID: 237797186
T4SS name [ID]VirB [382]
Gene symbolmpfJ
Locus tagpNAH20_p80
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]71114..72019 [-]
Producttype IV secretion VirB1-like protein
Component typeVirB1
UniProt IDC3KFS9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 3.2e-13, Aligned region: 34..164
Protein Sequence: 301 a.a.     [Download]
>gi|237797186|ref|YP_002887480.1| type IV secretion VirB1-like protein [Pseudomonas fluorescens]
MQKLPKFALAILASACLVGHVAAEETQQQRFSDLAAKCAPNVHASTLKALIGNESSFNPYAIGVVGTRLE
RQPKSLSEAIATAEKLERDGHRYAMGLGQLLMTNMRARGLSYQDVFEPCRNLQAISKLFTEYYTQALKTS
ATEQEALLKATSMYYSGNERLGFDADSPGGMSYVERVVDRASKPTADDPIVPAFDVQEATQAIPVIASTK
SPSKARKRAQGASEQPAGPWLTFTDGNGQAIAQAQPQAQQKSQIQVQLDTGDAPDEKRKFTAFDAPTANA
EPAAVPVQQEQTAPSFVQIIN
 
Nucleotide Sequence: 906 bp     [Download]
>gi|237797106|ref|NC_012674.1|:c72019-71114 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGCAAAAGCTGCCTAAATTCGCGCTGGCCATCCTTGCATCGGCCTGCCTTGTCGGCCACGTTGCCGCAG
AAGAAACCCAGCAACAACGCTTTTCAGATTTGGCCGCTAAGTGCGCGCCAAACGTCCATGCGTCGACGCT
AAAAGCCTTGATCGGTAATGAGTCGTCATTCAACCCATATGCCATTGGTGTGGTTGGTACTCGCCTTGAG
CGTCAGCCCAAGTCCCTGAGTGAAGCAATTGCCACAGCGGAGAAATTGGAACGTGACGGCCATCGCTACG
CGATGGGCCTGGGCCAATTGTTGATGACCAACATGCGAGCCCGGGGCCTGAGCTATCAGGATGTGTTCGA
ACCGTGCCGTAACCTGCAGGCCATCAGCAAGTTGTTCACTGAGTATTACACCCAAGCGCTCAAAACAAGT
GCTACTGAACAAGAAGCTCTTTTGAAAGCGACTTCCATGTATTACAGCGGTAACGAGCGGCTTGGCTTCG
ATGCTGATAGCCCTGGTGGAATGTCCTACGTCGAAAGGGTGGTCGACCGTGCAAGTAAACCAACGGCTGA
TGATCCGATTGTGCCCGCGTTCGACGTACAGGAAGCCACGCAAGCCATTCCTGTAATCGCTAGCACCAAG
TCACCCTCTAAAGCGCGCAAGCGCGCTCAGGGAGCCTCTGAGCAGCCTGCAGGGCCGTGGTTGACCTTCA
CGGATGGAAACGGTCAGGCGATAGCACAGGCACAGCCTCAAGCGCAGCAGAAGTCGCAGATTCAGGTCCA
GTTGGATACCGGTGATGCGCCCGATGAGAAACGGAAGTTCACAGCCTTCGACGCTCCGACAGCTAATGCT
GAGCCAGCGGCAGTGCCCGTGCAGCAGGAACAAACGGCCCCTTCATTCGTACAGATAATCAACTGA
 Primer design