SecReT4
Protein ID: 237797187
T4SS name [ID]VirB [382]
Gene symbolmpfI
Locus tagpNAH20_p81
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]72003..73031 [-]
Producttype IV secretion VirB11-like protein
Component typeVirB11
UniProt IDC3KFT0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.6e-59, Aligned region: 15..322
Protein Sequence: 342 a.a.     [Download]
>gi|237797187|ref|YP_002887481.1| type IV secretion VirB11-like protein [Pseudomonas fluorescens]
MSEIASFRQKLRSFDFLLDDPAVSEIAINGPGNVWAAYRGSRFMRPVVVDGVTLPLIKSLAELIAAHTEQ
EVNAYAPILSGRIPMDMSDHVADSERGDYRVQCVLAPAVEQHIGGIVCIRKPGRVQLTMDQYIASGAFDQ
INEARTPDQYSDDHLVELYRAKRWSEFFIGCVKAHKNIMISAGTNAGKSTFLNMLLQHVDPNERIVTIED
TREIRLKSENVVHLIYSRGGQGKARVTPFDHLESILRLTPDRAIMGELRGAEAYPYLELLNTGHSGSFST
IHSDSPDLMFDRLASMASRGGSDMTKNQLVEFSRHLIDVVIQWEYGFDGRRFITEVQYAKAA
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|237797106|ref|NC_012674.1|:c73031-72003 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGTCTGAGATTGCTTCGTTCCGCCAAAAGCTGCGCAGTTTTGATTTCCTGCTCGATGACCCAGCGGTAT
CCGAGATCGCTATTAATGGTCCAGGCAACGTATGGGCCGCGTATCGCGGTAGCCGGTTCATGCGCCCAGT
CGTTGTGGATGGCGTCACCCTTCCGCTGATCAAGTCGCTGGCCGAGTTGATTGCGGCGCATACAGAGCAA
GAGGTCAACGCTTATGCGCCGATCCTGTCCGGTCGCATCCCTATGGACATGAGCGACCACGTAGCGGACT
CGGAACGTGGCGACTATCGGGTCCAGTGCGTGCTTGCGCCTGCCGTTGAGCAACATATCGGCGGCATCGT
CTGTATTCGTAAACCTGGCCGCGTTCAGCTGACGATGGACCAATACATCGCTTCGGGAGCGTTTGACCAG
ATCAACGAGGCACGCACGCCAGATCAGTACAGCGATGATCACCTGGTCGAGTTGTACCGCGCCAAGCGCT
GGTCGGAATTTTTCATTGGGTGCGTCAAGGCCCACAAAAACATCATGATTTCGGCAGGGACAAACGCGGG
CAAAAGCACCTTCCTCAACATGCTGTTGCAGCATGTAGACCCTAATGAGCGGATCGTCACAATCGAAGAT
ACCCGCGAGATCCGTCTCAAAAGCGAGAACGTGGTTCATTTGATCTATTCCCGTGGTGGCCAAGGCAAAG
CGCGGGTCACGCCGTTTGATCACCTTGAGTCGATTCTTCGTCTTACGCCTGACCGCGCAATCATGGGCGA
GCTTCGCGGTGCTGAGGCTTACCCCTATCTTGAATTGCTGAACACCGGCCATAGCGGTTCATTCAGCACT
ATCCACTCGGACAGCCCCGACCTGATGTTTGACCGGCTTGCGTCGATGGCATCGCGTGGCGGCTCTGACA
TGACCAAAAACCAACTTGTGGAATTCTCACGTCACCTGATCGACGTAGTGATCCAGTGGGAATACGGCTT
TGATGGCCGTCGTTTCATCACGGAGGTGCAATATGCAAAAGCTGCCTAA
 Primer design