SecReT4
Protein ID: 237797188
T4SS name [ID]VirB [382]
Gene symbolmpfH
Locus tagpNAH20_p82
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]73041..74324 [-]
Producttype IV secretion VirB10-like protein
Component typeVirB10
UniProt IDC3KFT1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.9e-56, Aligned region: 223..407
Protein Sequence: 427 a.a.     [Download]
>gi|237797188|ref|YP_002887482.1| type IV secretion VirB10-like protein [Pseudomonas fluorescens]
MAKEPIKPTDQQADKTREEEMAEWNESQSNSMLKAGSGGKRSGVLMIGAAVVACGFVYWLKHDSGEPAAP
AKNDEIVAAERRKVQDPTPKREAAKVKPVSNDGEPGAPADTPRSTAERQTNQEGLSEAEKQRQALEFQEE
VARKKMLAARQRSAIFATAKDDGFAQGRDDQDPAQPPAGGSLLGGNSGNSGRVSRNANENFASSTYSTGV
PVAKARALENLQYKVLQGAAIEATLQPRAQSQLPGQICVTTAQDVYAAEGRRVMIPWGSSVCGSYNASLS
PGQERLFTVWNWLRMPKLPGRRAMEIALDSAGSDQLGSAGQGGVVDNHWAQIFGVAAAVSIIGAGASNSG
VSSGDQENSASQYRTEVQQAAAESSQTILSRYANIQPTVTVPHGSRVVIYLQRDLDFTEQFAEEAKEADN
GGVKFIN
 
Nucleotide Sequence: 1284 bp     [Download]
>gi|237797106|ref|NC_012674.1|:c74324-73041 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGGCGAAGGAACCTATCAAACCAACTGATCAGCAAGCGGACAAAACCCGCGAAGAAGAAATGGCCGAGT
GGAACGAGTCGCAATCGAACTCGATGCTAAAGGCTGGTTCTGGTGGAAAGCGCAGCGGCGTTCTTATGAT
TGGCGCAGCAGTTGTGGCGTGTGGTTTCGTTTACTGGCTCAAGCATGACAGTGGTGAACCAGCTGCCCCA
GCAAAAAACGATGAGATTGTCGCTGCTGAGCGCCGGAAGGTCCAAGACCCTACTCCCAAGCGCGAAGCGG
CGAAGGTAAAGCCAGTTAGCAACGATGGGGAGCCGGGCGCCCCAGCTGACACACCCCGTTCAACAGCTGA
GCGTCAGACCAACCAAGAGGGTTTGAGCGAAGCTGAAAAGCAGCGGCAAGCGTTGGAATTTCAAGAAGAA
GTTGCGCGCAAAAAGATGCTCGCTGCGCGTCAACGCTCGGCGATCTTTGCAACTGCAAAGGACGATGGTT
TTGCGCAAGGTCGTGACGATCAAGATCCAGCTCAACCACCAGCCGGTGGGTCGTTGCTGGGCGGTAACTC
GGGTAATTCCGGGCGCGTCTCCCGCAATGCAAACGAGAATTTCGCATCGTCGACTTACTCCACCGGCGTG
CCGGTGGCGAAAGCTCGGGCTCTGGAGAATTTGCAGTACAAGGTTCTGCAGGGCGCTGCAATCGAGGCGA
CTTTGCAGCCCCGTGCGCAGAGTCAATTGCCAGGTCAGATTTGCGTAACCACTGCACAGGACGTTTATGC
AGCGGAGGGTCGCCGCGTAATGATCCCTTGGGGGTCTTCGGTATGCGGAAGCTACAACGCCAGTCTTTCA
CCTGGTCAAGAGCGCCTGTTCACCGTTTGGAACTGGTTGCGTATGCCCAAGTTGCCGGGGCGTCGTGCAA
TGGAAATTGCTTTGGATAGCGCTGGCTCTGATCAGCTGGGCTCCGCTGGCCAGGGTGGTGTCGTTGATAA
CCACTGGGCGCAGATCTTCGGTGTTGCTGCTGCTGTCTCGATCATCGGCGCGGGTGCCTCCAACTCCGGC
GTTTCCTCTGGTGATCAAGAAAACTCGGCCTCTCAGTACCGTACTGAAGTGCAACAGGCTGCTGCTGAGT
CCTCGCAAACCATTCTTAGCCGGTACGCAAACATTCAACCAACAGTCACCGTTCCTCATGGCTCACGCGT
GGTGATCTACCTGCAGCGTGATTTGGACTTCACCGAACAGTTCGCCGAGGAAGCCAAAGAGGCTGACAAC
GGCGGCGTGAAATTCATTAACTGA
 Primer design