SecReT4
Protein ID: 237797189
T4SS name [ID]VirB [382]
Gene symbolmpfG
Locus tagpNAH20_p83
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]74327..75118 [-]
Producttype IV secretion VirB9-like protein
Component typeVirB9
UniProt IDC3KFT2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.6e-61, Aligned region: 34..244
Protein Sequence: 263 a.a.     [Download]
>gi|237797189|ref|YP_002887483.1| type IV secretion VirB9-like protein [Pseudomonas fluorescens]
MKKQFVLPTAITLSLALCAFNALAAKLPRALSSDNRVKQVPYDPNQIYELVGTYGYQTSIEFEADEMVKV
VALGDTISWQSMPFRNRVFLKPVEDNADTNMTVITSKRTYYFQLNSTKAKTSQSYLIRFVYPTSRVTSFN
DAAETPAPAATGPVTSTGTPSSPNINYGYSGDKEAIGLQGVMDDGQFTKFLMKKGADLPQFYRVLPDGTE
AMVNARREGEYWVVQRLASMFVVRSGNSYICVENLSNPYKRTVTRGARDGGGA
 
Nucleotide Sequence: 792 bp     [Download]
>gi|237797106|ref|NC_012674.1|:c75118-74327 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGAAAAAACAGTTCGTTCTACCGACAGCTATTACCCTGAGTTTGGCTTTGTGTGCATTTAATGCACTAG
CTGCAAAGTTGCCGAGGGCTCTGTCCTCTGACAACCGTGTCAAACAAGTGCCCTATGACCCAAACCAAAT
TTACGAACTGGTCGGCACTTACGGATACCAAACATCCATTGAGTTCGAAGCGGATGAAATGGTCAAGGTC
GTAGCACTTGGTGACACGATTTCCTGGCAGAGCATGCCATTCCGTAACCGGGTTTTCTTGAAGCCCGTGG
AAGACAATGCAGACACAAACATGACGGTGATTACATCCAAGCGGACGTATTACTTTCAGCTCAACAGTAC
GAAGGCGAAAACAAGTCAGTCGTACTTGATCCGATTCGTTTATCCGACCAGCCGTGTCACATCGTTTAAC
GATGCAGCGGAAACCCCAGCGCCTGCGGCTACTGGGCCAGTCACCAGCACCGGTACTCCTTCTTCCCCGA
ACATCAACTACGGCTATTCGGGTGACAAAGAAGCCATCGGCCTGCAGGGCGTTATGGATGATGGTCAGTT
CACCAAGTTTTTGATGAAGAAGGGTGCGGATCTCCCGCAGTTTTACCGCGTGCTGCCTGATGGCACCGAG
GCGATGGTCAATGCTCGCCGCGAGGGTGAGTATTGGGTGGTTCAGCGCCTGGCCAGCATGTTCGTGGTGC
GCAGCGGCAATTCCTACATCTGCGTTGAAAACCTTTCGAATCCGTATAAACGCACTGTTACTCGGGGTGC
GCGTGATGGGGGAGGGGCATAA
 Primer design