SecReT4
Protein ID: 237797190
T4SS name [ID]VirB [382]
Gene symbolmpfF
Locus tagpNAH20_p84
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]75143..75808 [-]
Producttype IV secretion VirB8-like protein
Component typeVirB8
UniProt IDC3KFT3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.7e-41, Aligned region: 12..217
Protein Sequence: 221 a.a.     [Download]
>gi|237797190|ref|YP_002887484.1| type IV secretion VirB8-like protein [Pseudomonas fluorescens]
MDKTLKKDEIARRQRQLEHKKVKQERNRSYFLNGAFALALVGSTIAIAFLAETKTFVNVVTVIGADNEVL
KQRTVTAENVDKEQAVIEGVLFDFIRACNTFDPRRKQQLSDTCHTYMTRNVAVEYEKEISPDNARNPYAS
LGENDWIEAQPKRMNKIGDEYQVIFISTNHKWGDKEPRVTSYLATIKVAHTMIPRALGDRWENPFGTLAT
LYRKSEELSRQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|237797106|ref|NC_012674.1|:c75808-75143 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGGACAAGACATTAAAGAAAGATGAGATTGCGCGCCGTCAGCGTCAACTCGAACACAAGAAGGTAAAAC
AAGAACGTAACCGTAGTTACTTTCTGAACGGTGCCTTCGCACTAGCCCTGGTGGGGTCGACCATAGCCAT
CGCGTTCCTGGCTGAAACAAAGACGTTCGTCAATGTGGTGACGGTGATCGGCGCCGATAATGAAGTGCTC
AAGCAGCGCACGGTTACGGCGGAAAACGTCGACAAAGAGCAGGCTGTCATCGAAGGCGTTCTGTTTGATT
TCATTCGTGCTTGTAACACCTTTGACCCTCGGCGCAAGCAACAGCTGTCCGATACCTGCCACACGTACAT
GACCCGCAATGTCGCTGTCGAATATGAGAAGGAGATCAGCCCCGATAACGCGCGCAATCCATACGCATCG
CTCGGGGAAAACGACTGGATCGAAGCCCAACCCAAGCGCATGAACAAGATTGGCGATGAGTATCAGGTGA
TATTCATTTCAACCAATCACAAGTGGGGTGACAAAGAGCCAAGGGTTACTTCCTACCTGGCAACTATAAA
GGTTGCACACACGATGATCCCTAGAGCCTTGGGTGATCGTTGGGAAAACCCGTTTGGCACCTTGGCAACT
TTATACCGTAAGAGTGAAGAACTGAGCCGCCAGTAA
 Primer design