SecReT4
Protein ID: 237797191
T4SS name [ID]VirB [382]
Gene symbolmpfE
Locus tagpNAH20_p85
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]75812..76675 [-]
Producttype IV secretion VirB6-like protein
Component typeVirB6
UniProt IDC3KFT4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-35, Aligned region: 41..264
Protein Sequence: 287 a.a.     [Download]
>gi|237797191|ref|YP_002887485.1| type IV secretion VirB6-like protein [Pseudomonas fluorescens]
MADLTLKGLIGATDEVTTSFVAEVFPNLAGLVEPLVWTIAVAYWAVLGIQTYNGKISVAPWDIVKRAMLT
FMVFLTLNWSTGGSALYQIWGTWTETIAAQIMSRGVDSTSMLDALYVNVGQVASTLMNVSWRQFGMIIMG
SGLFMVNCILFIAAILNMLIAKFGAAIIMCILPILLGFIFFEQTRQWTMSWFSKMLNLSLIYILSIAIVR
FGYAIFGQAIDEIANTATISDAALITAQQWGTLIIVEGVLIICLLQVRGWAAAIATSATVGGSSLAMMAL
RTVGLGK
 
Nucleotide Sequence: 864 bp     [Download]
>gi|237797106|ref|NC_012674.1|:c76675-75812 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGGCGGACCTAACCCTCAAGGGCCTGATTGGGGCGACCGATGAGGTGACAACTAGCTTTGTCGCCGAGG
TCTTCCCAAATCTCGCTGGCTTGGTAGAGCCTCTGGTCTGGACAATCGCCGTCGCATATTGGGCAGTCCT
GGGTATTCAGACCTATAACGGCAAAATCTCTGTTGCGCCGTGGGACATTGTTAAACGGGCAATGCTCACG
TTTATGGTCTTCCTGACGCTTAATTGGTCAACGGGTGGGTCGGCGCTCTATCAGATTTGGGGTACTTGGA
CTGAAACCATTGCGGCACAAATCATGAGCCGAGGTGTTGATAGCACTTCAATGCTTGACGCGCTTTATGT
GAATGTCGGACAGGTTGCAAGCACGCTGATGAACGTTAGCTGGCGTCAGTTTGGCATGATCATCATGGGT
TCCGGTTTGTTTATGGTGAACTGCATTCTGTTTATCGCTGCAATCCTGAATATGCTGATTGCCAAGTTTG
GCGCAGCAATAATTATGTGCATATTGCCAATACTGCTCGGTTTCATATTTTTCGAACAAACGCGGCAATG
GACAATGAGCTGGTTTAGCAAAATGCTGAACTTATCGCTGATCTACATATTGTCCATCGCGATTGTTCGT
TTTGGTTATGCGATTTTCGGCCAAGCAATTGATGAGATCGCCAATACAGCCACCATTTCGGATGCTGCAT
TGATCACCGCTCAACAATGGGGAACTCTTATCATCGTTGAAGGCGTGTTGATCATCTGCTTGTTGCAAGT
TCGTGGGTGGGCAGCTGCGATTGCTACCAGCGCAACAGTCGGTGGTTCTTCACTGGCGATGATGGCATTG
CGAACCGTAGGATTGGGGAAATAA
 Primer design