SecReT4
Protein ID: 237797194
T4SS name [ID]VirB [382]
Gene symbolmpfD
Locus tagpNAH20_p88
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]77300..77989 [-]
Producttype IV secretion VirB5-like protein
Component typeVirB5
UniProt IDC3KFT7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 4e-47, Aligned region: 26..217
Protein Sequence: 229 a.a.     [Download]
>gi|237797194|ref|YP_002887488.1| type IV secretion VirB5-like protein [Pseudomonas fluorescens]
MMKTIKKLSLAIAVSMAITGQAGATGVPTGDAGTWAGLAQNLAELREQYKVLKQQYETQTDIMNNMRGSY
GRGAIGLSDSINSASVVPGSWQEVVSRQNSGAYGSKQSYYEELVNTLPQELFANPDSNRARGYQLSSNSV
VAAMSAGEALYSEVQVHLNNLTTLSMQVDNTTNAKDAADLQNRIATENGMLTSAQSKLQALNMNLQTNLA
NQENQATSQNEQFFRWKKD
 
Nucleotide Sequence: 690 bp     [Download]
>gi|237797106|ref|NC_012674.1|:c77989-77300 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGATGAAGACGATAAAGAAACTGAGTTTGGCCATTGCCGTATCCATGGCAATTACCGGTCAGGCAGGCG
CAACAGGCGTGCCAACTGGCGACGCGGGCACCTGGGCTGGACTGGCTCAAAACCTTGCGGAGCTGCGTGA
GCAATACAAGGTGCTGAAACAGCAGTACGAAACGCAAACCGACATTATGAACAACATGCGCGGTTCCTAT
GGCCGTGGCGCTATCGGCCTGAGCGATTCGATCAACTCTGCATCGGTGGTTCCCGGTTCCTGGCAAGAAG
TGGTTTCGCGTCAGAACTCTGGTGCCTACGGCAGCAAGCAGTCGTATTACGAGGAACTGGTCAACACCTT
GCCGCAAGAGCTGTTCGCCAATCCTGACAGCAACCGGGCACGGGGCTACCAGCTCAGCTCTAACTCTGTC
GTTGCCGCCATGTCTGCCGGTGAGGCGCTGTACAGCGAGGTACAGGTTCACTTGAACAACCTGACCACCC
TTTCAATGCAAGTGGATAACACCACCAACGCGAAGGATGCCGCCGATCTGCAAAACCGGATCGCCACTGA
AAACGGGATGCTCACTTCGGCCCAGTCAAAGCTGCAGGCGTTGAACATGAACCTGCAGACGAACCTGGCT
AATCAGGAAAACCAAGCAACGTCGCAGAACGAACAGTTCTTCCGTTGGAAAAAAGACTAA
 Primer design