SecReT4
Protein ID: 237797195
T4SS name [ID]VirB [382]
Gene symbolmpfC
Locus tagpNAH20_p89
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]77986..80670 [-]
Producttype IV secretion VirB4-like protein
Component typeVirB4
UniProt IDC3KFT8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.3e-21, Aligned region: 258..462
AAA_10 [PF12846], Evalue: 3.3e-18, Aligned region: 524..795
Protein Sequence: 894 a.a.     [Download]
>gi|237797195|ref|YP_002887489.1| type IV secretion VirB4-like protein [Pseudomonas fluorescens]
MRLVDKAFNKLVRNMDLSLGVQHPEGSDQDLDELVVSEMVPYDVHYDDQTVITGEDSLVQVIKIDGLMFD
SLTSTQIKLFEERRNTVLRTVASSDFAIYVHVIRRKVIDFPEGQGGTWFSKYFNARLRKRYVNRGFYVNE
IYISLVRNRFRSGVPGLMDRAIALVTGNSAADEAGETHEAMADSLYKAANLVLRGLSDYGATRLCIQRHP
TATNGVVDREAAYQAVSRFQWKWDDFKVQLGDHAEYDAEAVYDYLGEEYCELSSFFNYLINLEFRKIPVT
ELKIKEALPYARLNFRILANMCEIRGSTSARIGSMLSMAEWPRRTPSRMMNKFLQQPVEFIITQSFFFEN
RIEAESAMMDETRRLKVADPHKISEDDAKELAEGIRALRRGDTVNGKHHLTIFIHVPSDANTTAESRKAN
VKRLDDAVGLIEGCFVDLNVKSVREWLALETFFWSQLPGQQEALIGRRGKIKSTNFAGFASLHNFARGRR
DGNLWGPAITAFETESGTQYNFNYHRELEGMVAGHTGVAAGTGSGKTALIAETVSEADKALPVVYWFDMR
YGATVFMMAMGGVHSILSPHNSMGWNPFKLPDTAENRAYLIDLQIQMRECYASTATEADDIKRFKDAVNE
NYELPFENRRLRNVVWTYGHGALADVMAIWHGAKGIEGANAGVFDNENDTFDLSKSRHYCFEMSELMKGG
DARPELPVVMSYPLHCIEQAMDGRPFILVLDEGQNLVKNDFWRNRIDNFIMQIRRKNGILIFITPDAKYF
HSETDSIDKQTVTKIYLASDSVKDEDHKNLTEEEKKWLRELNPKDRKFLIRRGQESIRACFDLSSDNPDE
DLSDFIPVLSSNDVGVALMYSIIERLGTNDPEVWVPVFMAEAKANNTHNLKAIR
 
Nucleotide Sequence: 2685 bp     [Download]
>gi|237797106|ref|NC_012674.1|:c80670-77986 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGCGCCTCGTTGATAAAGCTTTTAATAAGCTAGTGCGAAATATGGATCTTTCGCTTGGTGTCCAACATC
CAGAAGGGTCCGATCAGGATCTCGATGAGTTGGTGGTCAGCGAGATGGTGCCGTATGACGTGCATTATGA
CGATCAAACAGTCATCACCGGCGAGGATTCACTGGTGCAGGTCATCAAGATTGATGGCCTGATGTTCGAC
TCGCTCACTAGCACGCAAATCAAGCTGTTCGAAGAACGCCGCAATACCGTGCTACGCACAGTGGCAAGCA
GTGATTTTGCCATTTACGTTCATGTCATCCGCCGTAAGGTGATCGACTTTCCCGAAGGGCAGGGCGGTAC
TTGGTTCTCCAAGTATTTCAATGCCCGGTTGCGCAAGCGCTATGTGAACAGAGGTTTCTACGTCAACGAG
ATCTATATCTCGCTGGTTCGGAATCGCTTTCGCTCTGGCGTTCCAGGGCTCATGGATCGGGCAATTGCGC
TGGTCACTGGTAACTCAGCTGCAGATGAAGCAGGCGAGACACATGAAGCCATGGCGGACTCGCTCTACAA
GGCCGCAAACCTTGTACTGCGAGGCTTGTCCGACTACGGCGCTACTCGTCTGTGCATCCAGCGTCATCCG
ACCGCAACCAATGGTGTAGTTGATCGCGAAGCTGCATATCAAGCAGTGTCCCGCTTCCAGTGGAAATGGG
ACGACTTCAAGGTGCAGCTTGGTGATCACGCTGAGTACGACGCAGAAGCTGTTTACGATTACCTGGGCGA
GGAATACTGCGAGCTGAGCAGCTTCTTCAACTACTTGATCAACCTTGAGTTCCGGAAGATCCCCGTCACT
GAACTGAAAATCAAGGAGGCTTTGCCCTACGCCCGGTTGAATTTCCGCATCCTTGCAAACATGTGTGAGA
TTCGAGGCAGTACGTCAGCACGCATCGGTTCCATGTTGAGCATGGCCGAATGGCCGCGTCGTACACCGTC
GCGCATGATGAACAAATTCCTTCAGCAGCCAGTTGAATTCATCATCACTCAGTCGTTTTTCTTCGAAAAC
CGTATTGAAGCTGAATCCGCGATGATGGATGAAACCCGGCGTCTCAAGGTTGCAGATCCACACAAAATCT
CGGAGGACGATGCAAAGGAACTGGCAGAGGGTATTCGTGCTTTGCGCCGTGGCGATACGGTCAATGGAAA
ACATCACCTGACCATTTTCATTCACGTTCCATCAGACGCAAACACTACCGCCGAGAGCCGCAAAGCGAAT
GTGAAGCGACTGGATGATGCAGTTGGTTTGATCGAAGGGTGCTTTGTCGACCTGAACGTCAAGTCGGTTC
GTGAGTGGTTGGCTCTTGAGACGTTCTTCTGGTCGCAGCTACCTGGTCAACAAGAAGCTCTTATCGGTCG
CCGGGGAAAGATCAAGTCAACCAACTTTGCGGGCTTCGCATCGTTGCACAACTTTGCTCGCGGACGTCGT
GACGGCAACCTGTGGGGCCCTGCAATCACTGCTTTCGAAACCGAAAGTGGCACTCAATACAACTTCAACT
ACCACCGTGAATTGGAAGGGATGGTCGCTGGCCACACTGGCGTGGCTGCAGGCACCGGCTCGGGTAAAAC
CGCATTGATCGCTGAAACCGTCAGTGAAGCGGACAAAGCCTTGCCGGTTGTGTACTGGTTTGACATGCGC
TACGGGGCCACCGTTTTCATGATGGCCATGGGCGGCGTCCATTCGATCCTTTCCCCACACAACAGCATGG
GTTGGAACCCCTTCAAATTGCCTGACACGGCTGAGAACCGTGCCTACCTCATTGATCTGCAGATCCAGAT
GCGGGAGTGCTACGCAAGCACCGCAACTGAGGCCGACGATATCAAGCGGTTCAAGGATGCAGTGAACGAG
AACTACGAGCTGCCATTCGAAAATCGCCGGTTGCGCAATGTCGTATGGACCTACGGGCACGGCGCCTTAG
CTGACGTTATGGCTATTTGGCATGGTGCCAAAGGAATCGAAGGTGCAAACGCCGGCGTTTTTGATAACGA
AAATGACACTTTCGATCTCAGTAAGTCGCGGCATTACTGCTTTGAAATGTCGGAGCTGATGAAGGGCGGC
GATGCACGCCCGGAATTGCCAGTAGTGATGAGCTACCCATTGCACTGCATTGAGCAGGCTATGGATGGCA
GACCTTTCATTCTGGTTTTGGATGAAGGTCAGAACCTGGTCAAAAACGATTTTTGGCGCAATCGAATTGA
CAATTTCATCATGCAGATCCGCCGTAAAAACGGGATTTTGATCTTCATCACCCCGGACGCGAAGTACTTC
CACAGTGAAACCGACTCCATCGACAAGCAGACCGTAACCAAGATCTACCTGGCCAGCGACTCGGTGAAAG
ACGAAGACCATAAGAACCTGACGGAGGAAGAAAAGAAGTGGTTGCGCGAGCTGAACCCAAAGGATCGCAA
GTTCTTGATTCGTCGCGGCCAGGAATCGATTCGTGCGTGCTTCGACCTGTCCTCCGATAACCCTGACGAA
GACCTGTCCGATTTCATTCCGGTCCTGTCTTCAAACGATGTTGGTGTGGCCTTGATGTACTCAATCATTG
AGCGCCTGGGCACCAATGACCCCGAGGTCTGGGTGCCAGTTTTCATGGCAGAAGCCAAGGCCAATAACAC
CCACAACTTGAAGGCAATTCGATGA
 Primer design