SecReT4
Protein ID: 237797196
T4SS name [ID]VirB [382]
Gene symbolmpfB
Locus tagpNAH20_p90
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]80657..80950 [-]
Producttype IV secretion VirB3-like protein
Component typeVirB3
UniProt IDC3KFT9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.5e-14, Aligned region: 1..92
Protein Sequence: 97 a.a.     [Download]
>gi|237797196|ref|YP_002887490.1| type IV secretion VirB3-like protein [Pseudomonas fluorescens]
MAEQDPDEGEVLVVAMARPSMVGPFTLSSILISLITPVLAALLLRSLYVLVTMPILFAAAYWICSKDVYL
FGVLRAAFKLRASRLRKLWGYRSYAPR
 
Nucleotide Sequence: 294 bp     [Download]
>gi|237797106|ref|NC_012674.1|:c80950-80657 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGGCCGAGCAAGATCCTGATGAAGGTGAAGTGCTCGTAGTGGCGATGGCCCGGCCATCAATGGTGGGGC
CGTTTACCTTATCGAGTATTTTGATCAGCCTCATAACCCCAGTGTTGGCAGCACTGTTACTTCGATCACT
TTATGTGCTCGTTACGATGCCAATACTGTTTGCCGCTGCGTACTGGATCTGTAGCAAAGACGTGTACTTG
TTTGGTGTGCTTAGAGCGGCATTCAAGTTGAGAGCATCACGGCTACGTAAACTGTGGGGATATAGAAGTT
ATGCGCCTCGTTGA
 Primer design