SecReT4
Protein ID: 237797197
T4SS name [ID]VirB [382]
Gene symbolmpfA
Locus tagpNAH20_p91
StrainPseudomonas fluorescens plasmid pNAH20 (NC_012674)
Repliconplasmid pNAH20 [GenBank: NC_012674] [Browse all T4SS(s) in this replicon]
Location [Strand]80954..81415 [-]
Producttype IV secretion VirB2-like protein
Component typeVirB2
UniProt IDC3KFU0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.2e-18, Aligned region: 49..144
Protein Sequence: 153 a.a.     [Download]
>gi|237797197|ref|YP_002887491.1| type IV secretion VirB2-like protein [Pseudomonas fluorescens]
MQSQTSKVGRTVEGLHKESWRTWLKAKASQTLQSVISQKTPSHKALMRNDRMAKATKLATLGSILSLALI
PEFANAALDFSGLKSMAKDFVSFLIFDVGYYLGIAAIAFCGFQAKSGRMSWGQFGWAVFGIFLVFFAPNF
VDTIKEGAQSSLR
 
Nucleotide Sequence: 462 bp     [Download]
>gi|237797106|ref|NC_012674.1|:c81415-80954 Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence
ATGCAATCTCAAACTTCCAAAGTTGGACGCACCGTAGAAGGACTGCACAAAGAAAGTTGGCGTACTTGGC
TCAAGGCCAAGGCATCACAAACCCTGCAAAGCGTAATCTCGCAAAAGACCCCGTCGCACAAAGCGCTGAT
GCGTAATGACCGTATGGCCAAGGCCACCAAGTTAGCGACGCTGGGGTCGATTCTCTCGCTGGCCCTGATC
CCTGAATTCGCAAATGCGGCACTGGACTTCAGTGGTTTGAAGAGCATGGCCAAGGACTTCGTATCCTTCC
TCATCTTTGACGTTGGTTACTACCTGGGTATCGCAGCCATTGCGTTCTGCGGATTCCAGGCGAAGTCCGG
TCGTATGTCGTGGGGCCAGTTCGGCTGGGCGGTATTCGGTATCTTCCTGGTGTTTTTTGCCCCGAACTTT
GTCGACACGATCAAAGAAGGCGCTCAATCAAGCTTGAGGTAA
 Primer design