SecReT4
Protein ID: 237809169
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2428
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2654915..2655478 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDC4L9S0
KEGG IDtau:Tola_2428
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 187 a.a.     [Download]
>gi|237809169|ref|YP_002893609.1| hypothetical protein Tola_2428 [Tolumonas auensis DSM 9187]
MPATQLLRRLTGSGLLITAVLSGGCATTAAPPVDPLVEEADTAPQSPELIPVVRYGRYTLVELVPTAAQR
DLLLQVIDVAMPADARATVGDGLRHALQRSGYQLCENAHAVIELYSLPLPAAHLYLGPMTLRDALLTLAG
PAWDVQVDDRARQICFVPAGEPSADPETDTPLAAPVQTFPIVDGGQP
 
Nucleotide Sequence: 564 bp     [Download]
>ref|NC_012691.1|:2654915-2655478 hypothetical protein Tola_2428 [Tolumonas auensis DSM 9187]
ATGCCAGCAACCCAACTTCTACGGCGCCTGACCGGCAGCGGCCTGCTGATCACCGCTGTGTTGAGCGGCG
GCTGCGCCACCACCGCCGCACCGCCCGTTGATCCTCTTGTCGAGGAAGCCGACACAGCGCCGCAGTCACC
TGAACTGATTCCGGTGGTGCGCTATGGCCGCTACACGCTCGTGGAGCTTGTTCCCACCGCGGCCCAGCGT
GACCTGCTGCTGCAGGTCATCGACGTGGCGATGCCAGCGGATGCCAGAGCGACGGTGGGCGACGGCCTGC
GCCACGCACTCCAGCGCAGCGGCTACCAGCTTTGCGAGAACGCCCATGCGGTGATCGAGCTGTATTCGCT
GCCGCTGCCGGCGGCGCACCTGTATCTGGGGCCGATGACGCTGCGCGACGCACTGCTCACGCTCGCCGGG
CCGGCCTGGGATGTACAGGTCGATGACAGGGCGCGCCAGATCTGCTTCGTTCCTGCCGGCGAGCCCTCCG
CAGATCCCGAGACCGACACGCCACTGGCCGCGCCGGTGCAGACCTTTCCCATCGTCGACGGAGGCCAGCC
ATGA
 Primer design