SecReT4
Protein ID: 237809171
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2430
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2656147..2656875 [+]
Productputative secreted protein
Component typeTfc3
UniProt IDC4L9S2
KEGG IDtau:Tola_2430
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 242 a.a.     [Download]
>gi|237809171|ref|YP_002893611.1| putative secreted protein [Tolumonas auensis DSM 9187]
MQRRALSMLFLLAALNAPAFAQQPATQSTPAQSSRVTPSQIDQARDERLARDWGLRGDEWGRYRELMEGP
LGIHSPNLDPLTALGIEARSDEERRRYAELQVQVEARRVEKLLAYQRAYDEAWQRLHPDAQRVNLPDALP
GGSAMTGSGRTAVFVRDGCAPCAQVVQRLQTANAEFDLYMVGSRQDDARIREWAQRAQIDPARVRSGSIT
LNHDGGRWLALGLPGELPAVVRQVNGQWQRQP
 
Nucleotide Sequence: 729 bp     [Download]
>ref|NC_012691.1|:2656147-2656875 putative secreted protein [Tolumonas auensis DSM 9187]
ATGCAACGTCGCGCACTTTCCATGCTGTTCCTGTTGGCCGCGCTGAACGCACCGGCCTTCGCGCAGCAGC
CCGCCACCCAGAGCACACCCGCACAGTCTTCCCGTGTCACGCCGAGCCAGATCGATCAGGCACGCGATGA
ACGCCTGGCGCGGGACTGGGGGCTGCGCGGCGACGAATGGGGACGCTACCGCGAACTGATGGAAGGGCCG
CTGGGCATCCATTCACCCAACCTCGACCCGCTGACCGCACTCGGCATCGAAGCCCGCTCCGACGAGGAGC
GACGGCGCTATGCCGAACTGCAAGTGCAGGTCGAAGCGCGCCGCGTGGAAAAGTTGCTGGCGTATCAACG
AGCCTACGACGAAGCCTGGCAACGCCTGCATCCCGACGCCCAGCGGGTGAATCTGCCCGATGCGCTGCCG
GGCGGCAGTGCGATGACCGGCAGCGGTCGTACCGCCGTGTTCGTCCGGGACGGCTGCGCGCCGTGTGCCC
AGGTCGTGCAGCGTCTGCAGACGGCGAACGCCGAGTTCGACCTGTACATGGTCGGCAGCCGCCAGGACGA
CGCGCGCATCCGCGAGTGGGCCCAGCGCGCGCAGATCGATCCGGCGCGCGTGCGCAGCGGCTCGATCACG
CTCAACCACGACGGTGGCCGCTGGCTGGCGCTGGGTTTGCCCGGTGAACTGCCCGCGGTGGTGCGTCAGG
TGAACGGCCAATGGCAGCGCCAGCCCTGA
 Primer design