SecReT4
Protein ID: 237809172
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2431
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2656857..2657447 [+]
ProductLytic transglycosylase catalytic
Component typeTfc4
UniProt IDC4L9S3
KEGG IDtau:Tola_2431
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|237809172|ref|YP_002893612.1| Lytic transglycosylase catalytic [Tolumonas auensis DSM 9187]
MAAPALMPTWPLRVLLAAALATGPVQAQEIPPPAYQLAAQRAGIPSTVLYAVALQESGVRRDDRIVPWPW
SLNVAGQSRRYATRAQACAGVRQALREVPPTRIDVGLGQINLGYQQHRYRQPCDLLDPYDNLRIAADILK
EQHTPGEDWLLAVGRYHRPAGGAPAARYRRSVSQYLQRVLGPQQTAAHAPRQENSR
 
Nucleotide Sequence: 591 bp     [Download]
>ref|NC_012691.1|:2656857-2657447 Lytic transglycosylase catalytic [Tolumonas auensis DSM 9187]
ATGGCAGCGCCAGCCCTGATGCCGACGTGGCCGCTGCGCGTGCTGCTGGCCGCCGCGCTGGCGACCGGGC
CAGTCCAGGCCCAGGAAATTCCGCCGCCCGCCTACCAGTTGGCGGCCCAGCGCGCCGGCATTCCTTCGAC
GGTGCTCTATGCCGTGGCGCTGCAGGAAAGCGGCGTGCGCCGGGACGATCGCATCGTGCCGTGGCCCTGG
TCGCTCAATGTCGCCGGCCAGTCGCGCCGCTACGCCACGCGCGCGCAGGCTTGTGCGGGCGTGCGCCAGG
CGCTGCGCGAGGTGCCCCCCACGCGCATCGACGTGGGCTTGGGCCAGATCAACCTCGGCTACCAGCAGCA
CCGCTACCGCCAGCCCTGCGATCTGCTCGACCCCTACGACAACCTGCGCATCGCCGCCGACATCCTGAAA
GAGCAGCACACCCCCGGCGAAGACTGGCTGCTGGCGGTCGGGCGTTACCACCGACCGGCTGGCGGCGCGC
CCGCGGCGCGTTACCGGCGCAGCGTTTCACAATACCTCCAGCGCGTGCTCGGCCCGCAACAGACCGCCGC
ACACGCGCCCCGCCAGGAGAACAGCCGATGA
 Primer design