SecReT4
Protein ID: 237809173
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2432
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2657444..2657989 [+]
Productputative secreted protein
Component typeTfc5
UniProt IDC4L9S4
KEGG IDtau:Tola_2432
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 2.2e-53, Aligned region: 33..180
Protein Sequence: 181 a.a.     [Download]
>gi|237809173|ref|YP_002893613.1| putative secreted protein [Tolumonas auensis DSM 9187]
MTSSIRATHGLLVVMLATVPMSAVRATPPLIVVEDRGGASALPYYEALDLQPRATSQPLPSIVIPEAPTA
AVDETAMLPVRSARLTPGTVARRVIEAPGLQPFFLVGDDATSQAWLRQHADTLRQRNAWGLVVNVETAQA
LAQLRAIAPGLNLSPMSADDLAERLGLRHYPVLVTATGIEQ
 
Nucleotide Sequence: 546 bp     [Download]
>ref|NC_012691.1|:2657444-2657989 putative secreted protein [Tolumonas auensis DSM 9187]
ATGACCTCATCCATCCGGGCCACGCACGGCCTTCTTGTCGTAATGCTCGCCACCGTGCCGATGAGCGCGG
TGCGTGCCACGCCGCCCCTGATCGTGGTGGAAGACCGGGGCGGCGCTTCCGCGCTGCCGTACTACGAAGC
GCTCGACCTGCAGCCGCGCGCCACGAGTCAGCCACTCCCCTCCATCGTCATTCCCGAGGCACCAACCGCC
GCTGTCGATGAGACGGCCATGCTGCCGGTGCGCAGTGCCAGGCTCACGCCGGGAACGGTTGCCCGCCGTG
TCATCGAGGCCCCCGGACTGCAACCATTCTTCCTGGTCGGTGACGATGCGACCTCTCAAGCCTGGTTGCG
TCAGCACGCCGACACGCTGCGCCAACGCAACGCCTGGGGCCTGGTGGTCAATGTCGAGACGGCCCAGGCG
CTGGCACAACTGCGTGCAATCGCGCCCGGCCTGAATCTGTCGCCGATGTCCGCCGACGATCTGGCCGAAC
GCCTGGGCCTGCGGCATTACCCGGTGCTGGTCACGGCCACCGGCATCGAGCAATGA
 Primer design