SecReT4
Protein ID: 237809175
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2434
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2660180..2660929 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDC4L9S6
KEGG IDtau:Tola_2434
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 4.7e-71, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|237809175|ref|YP_002893615.1| hypothetical protein Tola_2434 [Tolumonas auensis DSM 9187]
MSDPASTAQRQQQRRQGLIATAISLPLRLFGVLIASLMLSILIECVGMHLFWKDQGWRHAQSMLQYELGH
LSNHFTRSAIVQEPGRTAHRLVETGYEWVFVKTGLLDKMNDTAERARAPGQGQSRDFRYFISQVYVWAER
YLIAAAFITLTFMVRLLVLVLTLPLVLTAVFVGLVDGLVRRDVRKFGAGRESGFVYHRAKASLLPLAILP
WVIYLAMPVSVHPLLILLPSAALLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>ref|NC_012691.1|:2660180-2660929 hypothetical protein Tola_2434 [Tolumonas auensis DSM 9187]
ATGAGCGACCCGGCATCCACTGCGCAGCGGCAGCAACAGCGCCGGCAGGGCCTGATCGCCACTGCGATCT
CCTTGCCGCTGCGCCTGTTCGGGGTACTGATCGCCTCGCTGATGCTGTCGATCCTGATCGAGTGCGTGGG
CATGCACCTGTTCTGGAAGGACCAGGGCTGGCGCCATGCGCAATCGATGCTGCAGTACGAGCTGGGGCAT
CTGTCGAATCACTTCACGCGCAGCGCCATCGTGCAGGAGCCAGGGCGCACCGCGCACCGTCTGGTGGAGA
CGGGTTACGAGTGGGTGTTCGTCAAGACCGGGCTGCTCGACAAGATGAACGATACCGCAGAACGCGCCCG
CGCGCCGGGCCAAGGACAATCCCGTGATTTCCGCTACTTCATCAGCCAAGTCTATGTCTGGGCCGAGCGC
TATCTGATTGCCGCCGCTTTCATCACCTTGACCTTTATGGTGCGCCTGCTGGTTCTGGTATTGACACTGC
CGCTGGTGCTCACGGCAGTGTTCGTCGGTCTGGTCGATGGACTGGTGCGCCGCGACGTGCGCAAGTTCGG
CGCCGGCCGGGAATCGGGCTTCGTCTACCATCGCGCGAAAGCCTCGCTACTGCCACTGGCGATACTGCCC
TGGGTGATCTACTTGGCGATGCCGGTCTCGGTGCATCCACTGCTGATTCTGTTACCCAGCGCCGCCTTAC
TGGGACTGGCTGTATCTCTGACTGCGGGGAGCTTCAAAAAGTACCTGTAG
 Primer design