SecReT4
Protein ID: 237809177
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2436
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2662464..2662841 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDC4L9S8
KEGG IDtau:Tola_2436
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.2e-29, Aligned region: 30..109
Protein Sequence: 125 a.a.     [Download]
>gi|237809177|ref|YP_002893617.1| hypothetical protein Tola_2436 [Tolumonas auensis DSM 9187]
MVFSFPRHAAHRGVAALLLMALTASPPLAAHAGTPAQRQELAAALRQLDALERFVAQSAANTPITAGERY
HFDYPRLLDDLARVRAGIQFHLAPSRAQPRDPAVLSGDYRNESAPDVFSAPEAQP
 
Nucleotide Sequence: 378 bp     [Download]
>ref|NC_012691.1|:2662464-2662841 hypothetical protein Tola_2436 [Tolumonas auensis DSM 9187]
ATGGTGTTTTCGTTTCCACGCCACGCCGCGCATCGCGGCGTGGCCGCCCTGCTGCTGATGGCGCTGACGG
CGAGCCCGCCGCTGGCGGCCCATGCCGGCACGCCAGCCCAACGCCAGGAGCTGGCTGCGGCCCTGCGCCA
GCTCGACGCGCTGGAACGCTTCGTCGCACAGAGTGCGGCGAATACCCCGATCACAGCGGGCGAGCGCTAC
CACTTCGACTACCCACGTCTACTCGATGACCTCGCGCGCGTGCGCGCCGGCATCCAGTTCCACCTCGCGC
CGTCTCGCGCCCAGCCACGCGACCCCGCCGTACTGAGCGGCGATTACCGCAACGAGTCCGCCCCCGACGT
TTTCTCGGCACCGGAGGCCCAGCCATGA
 Primer design