SecReT4
Protein ID: 237809180
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2439
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2663461..2663859 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDC4L9T1
KEGG IDtau:Tola_2439
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3.3e-47, Aligned region: 10..130
Protein Sequence: 132 a.a.     [Download]
>gi|237809180|ref|YP_002893620.1| hypothetical protein Tola_2439 [Tolumonas auensis DSM 9187]
MSEHQHIRADGTVMFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWLFSTIAIAPTFIVLG
IAFGVFIGGGILRRQKRGRPDTWLYRQLQWRIATRYPLMAGWIGGHALITRSGRWSNRRVAR
 
Nucleotide Sequence: 399 bp     [Download]
>ref|NC_012691.1|:2663461-2663859 hypothetical protein Tola_2439 [Tolumonas auensis DSM 9187]
ATGTCCGAGCATCAGCACATCCGTGCGGACGGCACCGTGATGTTCCTTCCGCACCGGCTCAACCGGCATC
CCGTGGTGGTGCGCGGCCTGACGGCGGACGAGCTGTGGATCTGCTGCGGCCTGTCCGGCGCAGCCGGATT
GCTGGTCGGCGCGCCCCTGTCCTGGCTGTTCTCGACCATCGCGATCGCGCCCACCTTCATCGTGCTGGGT
ATCGCCTTCGGCGTGTTCATCGGCGGAGGCATCCTGCGCCGTCAGAAACGCGGCAGACCCGACACCTGGT
TGTACCGCCAACTGCAATGGCGCATCGCGACCCGCTATCCGTTGATGGCCGGCTGGATCGGCGGGCATGC
ACTGATCACGCGTTCGGGCCGCTGGTCGAACCGGAGGGTAGCGCGATGA
 Primer design